Property Summary

NCBI Gene PubMed Count 12
Grant Count 6
R01 Count 1
Funding $917,984
PubMed Score 39.53
PubTator Score 192.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis 1.450 0.000
malignant mesothelioma -1.500 0.000
astrocytic glioma -2.400 0.035
posterior fossa group B ependymoma -4.000 0.000
glioblastoma -2.900 0.000
oligodendroglioma -1.800 0.000
group 4 medulloblastoma -4.300 0.000
cystic fibrosis 1.165 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -1.400 0.014
primitive neuroectodermal tumor -2.200 0.000
non-small cell lung cancer -1.260 0.000
lung cancer -3.500 0.000
interstitial cystitis 1.200 0.000
lung adenocarcinoma -1.400 0.000
pediatric high grade glioma -2.800 0.000
pilocytic astrocytoma -3.300 0.000
subependymal giant cell astrocytoma -3.590 0.013
Breast cancer 1.100 0.015
lung carcinoma -2.000 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGSSRLRVFDPHLERKDSAAALSDRELPLPTFDVPYFKYIDEEDEDDEWSSRSQSSTEDDSVDSLLSDRY      1 - 70
VVVSGTPEKILEHLLNDLHLEEVQDKETETLLDDFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDV     71 - 140
PRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTIYRNVLDDVYEYPILEKELKEFQKILGMHRRHTVDE    141 - 210
YSPQKKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYITEHSYVSVKAKVSSIAQEILKVVAEKIQYAE    211 - 280
EDLALVAITFSGEKHELQPNDLVISKSLEASGRIYVYRKDLADTLNPFAENEESQQRSMRILGMNTWDLA    281 - 350
LELMNFDWSLFNSIHEQELIYFTFSRQGSGEHTANLSLLLQRCNEVQLWVATEILLCSQLGKRVQLVKKF    351 - 420
IKIAAHCKAQRNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFKKMK    421 - 490
PPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGDLSPKEHQELKSYVNHL    491 - 560
YVIDSQQALFELSHRIEPRV                                                      561 - 580
//

Text Mined References (12)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17903292 2007 A genome-wide association for kidney function and endocrine-related traits in the NHLBI's Framingham Heart Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10934204 2000 Identification of guanine nucleotide exchange factors (GEFs) for the Rap1 GTPase. Regulation of MR-GEF by M-Ras-GTP interaction.
10777494 2000 Mechanism of regulation of the Epac family of cAMP-dependent RapGEFs.
More...