Property Summary

NCBI Gene PubMed Count 12
PubMed Score 39.53
PubTator Score 192.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Amphetamine-Related Disorders 74
Disease Target Count P-value
lung carcinoma 2844 1.09722567614125E-17
posterior fossa group B ependymoma 1530 7.83371364542153E-17
lung adenocarcinoma 2714 7.21634353856272E-16
non-small cell lung cancer 2798 3.0643901146055E-13
pilocytic astrocytoma 3086 2.84827781204851E-11
group 4 medulloblastoma 1875 6.2062719572017E-10
pediatric high grade glioma 2712 6.85622887160871E-10
atypical teratoid / rhabdoid tumor 4369 7.86256544336182E-10
oligodendroglioma 2849 1.15160883406681E-9
glioblastoma 5572 1.00005765214727E-7
malignant mesothelioma 3163 4.48593874469692E-7
lung cancer 4473 5.02682295520025E-5
interstitial cystitis 2299 1.15797006327982E-4
nephrosclerosis 329 1.77106622143864E-4
primitive neuroectodermal tumor 3031 3.40026574813446E-4
cystic fibrosis 1670 3.95823565657719E-4
subependymal giant cell astrocytoma 2287 0.0126756785061608
medulloblastoma, large-cell 6234 0.0135804166039659
Breast cancer 3099 0.0149874454800298
astrocytic glioma 2241 0.0353084422019235

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis 1.450 0.000
malignant mesothelioma -1.500 0.000
astrocytic glioma -2.400 0.035
posterior fossa group B ependymoma -4.000 0.000
glioblastoma -2.900 0.000
oligodendroglioma -1.800 0.000
group 4 medulloblastoma -4.300 0.000
cystic fibrosis 1.165 0.000
atypical teratoid / rhabdoid tumor -3.800 0.000
medulloblastoma, large-cell -1.400 0.014
primitive neuroectodermal tumor -2.200 0.000
non-small cell lung cancer -1.260 0.000
lung cancer -3.500 0.000
interstitial cystitis 1.200 0.000
lung adenocarcinoma -1.400 0.000
pediatric high grade glioma -2.800 0.000
pilocytic astrocytoma -3.300 0.000
subependymal giant cell astrocytoma -3.590 0.013
Breast cancer 1.100 0.015
lung carcinoma -2.000 0.000

Synonym

Accession Q92565 A4D140 Q8IXU5
Symbols GFR
REPAC
MR-GEF

Gene

PDB

1WGY  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGSSRLRVFDPHLERKDSAAALSDRELPLPTFDVPYFKYIDEEDEDDEWSSRSQSSTEDDSVDSLLSDRY      1 - 70
VVVSGTPEKILEHLLNDLHLEEVQDKETETLLDDFLLTYTVFMTTDDLCQALLRHYSAKKYQGKEENSDV     71 - 140
PRRKRKVLHLVSQWIALYKDWLPEDEHSKMFLKTIYRNVLDDVYEYPILEKELKEFQKILGMHRRHTVDE    141 - 210
YSPQKKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYITEHSYVSVKAKVSSIAQEILKVVAEKIQYAE    211 - 280
EDLALVAITFSGEKHELQPNDLVISKSLEASGRIYVYRKDLADTLNPFAENEESQQRSMRILGMNTWDLA    281 - 350
LELMNFDWSLFNSIHEQELIYFTFSRQGSGEHTANLSLLLQRCNEVQLWVATEILLCSQLGKRVQLVKKF    351 - 420
IKIAAHCKAQRNLNSFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFKKMK    421 - 490
PPKIPFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGDLSPKEHQELKSYVNHL    491 - 560
YVIDSQQALFELSHRIEPRV                                                      561 - 580
//

Text Mined References (12)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17903292 2007 A genome-wide association for kidney function and endocrine-related traits in the NHLBI's Framingham Heart Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10934204 2000 Identification of guanine nucleotide exchange factors (GEFs) for the Rap1 GTPase. Regulation of MR-GEF by M-Ras-GTP interaction.
10777494 2000 Mechanism of regulation of the Epac family of cAMP-dependent RapGEFs.
More...