Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 8.46879569668265E-8
Pick disease 1893 4.29697434083511E-6
psoriasis 6685 2.15663900891043E-5
medulloblastoma, large-cell 6234 9.09230693075663E-5
lung cancer 4473 0.0039431057951383
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0105171336392536
progressive supranuclear palsy 674 0.0177250875456237
Alzheimer's disease 644 0.0259108739878168
osteosarcoma 7933 0.0326280938387571

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -2.100 0.000
osteosarcoma 1.210 0.033
medulloblastoma, large-cell -1.100 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.011
lung cancer 1.300 0.004
Alzheimer's disease -1.500 0.026
Pick disease -2.100 0.000
progressive supranuclear palsy -1.600 0.018
ovarian cancer -2.000 0.000

Synonym

Accession Q92564 B4DH25 Q7Z3F3 Q7Z6B8
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MHSDAAAVNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPA      1 - 70
SGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVVGPEGMEKFCEDIGVEPENVV     71 - 140
MLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFAREKDQR    141 - 210
SLDINTAKCMLGLLLGKIWPLFPVFHQFLEQSKYKVINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLD    211 - 280
EFVEWYKDKQMS                                                              281 - 292
//

Text Mined References (16)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
21911577 2011 A physical interaction network of dengue virus and human proteins.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15988528 2005 The conserved protein DCN-1/Dcn1p is required for cullin neddylation in C. elegans and S. cerevisiae.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...