Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
Alzheimer's disease -1.500 2.6e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.1e-02
lung cancer 1.300 3.9e-03
medulloblastoma, large-cell -1.100 9.1e-05
osteosarcoma 1.210 3.3e-02
ovarian cancer -1.500 4.4e-06
Pick disease -2.100 4.3e-06
progressive supranuclear palsy -1.600 1.8e-02
psoriasis -2.100 2.2e-05

AA Sequence

MHSDAAAVNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPA      1 - 70
SGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVVGPEGMEKFCEDIGVEPENVV     71 - 140
MLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFAREKDQR    141 - 210
SLDINTAKCMLGLLLGKIWPLFPVFHQFLEQSKYKVINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLD    211 - 280
EFVEWYKDKQMS                                                              281 - 292
//

Text Mined References (17)

PMID Year Title