Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.53
PubTator Score 9.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 2.27253211383415E-44
lung adenocarcinoma 2714 6.89097074899886E-32
non-small cell lung cancer 2798 2.45161791926744E-23
atypical teratoid/rhabdoid tumor 1095 1.00330922545376E-12
ovarian cancer 8492 4.54542037347369E-9
lung carcinoma 2844 1.22375881986381E-7
tuberculosis 1563 4.1398753967334E-7
adrenocortical carcinoma 1427 1.67344786257909E-6
osteosarcoma 7933 3.7842163766355E-5
medulloblastoma, large-cell 6234 5.55185869663225E-5
adult high grade glioma 2148 8.57642481209489E-5
lung cancer 4473 1.21908062262556E-4
group 3 medulloblastoma 2254 1.46258432072041E-4
glioblastoma 5572 3.53857550387871E-4
chronic lymphocytic leukemia 244 6.63935895224857E-4
oligodendroglioma 2849 0.00169942053496658
primary Sjogren syndrome 789 0.0038071800541826
cutaneous lupus erythematosus 1056 0.00477789613277422
interstitial cystitis 2299 0.00508133081437144
Breast cancer 3099 0.00527288149924698
astrocytoma 1493 0.00788915280583561
primitive neuroectodermal tumor 3031 0.024627370656105
ependymoma 2514 0.0287995613028847
subependymal giant cell astrocytoma 2287 0.0311103915962191
Disease Target Count Z-score Confidence
substance-related disorder 105 0.0 1.0
Disease Target Count Z-score Confidence
Endometriosis of ovary 4 3.792 1.9

Expression

  Differential Expression (24)

Disease log2 FC p
chronic lymphocytic leukemia 1.373 0.001
ependymoma 1.100 0.029
oligodendroglioma 1.100 0.002
cutaneous lupus erythematosus 2.000 0.005
osteosarcoma -1.951 0.000
glioblastoma -1.400 0.000
group 3 medulloblastoma -2.100 0.000
astrocytoma 1.500 0.008
atypical teratoid/rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.600 0.025
adrenocortical carcinoma -2.018 0.000
tuberculosis -1.700 0.000
non-small cell lung cancer -2.580 0.000
lung cancer -2.000 0.000
interstitial cystitis 1.700 0.005
lung adenocarcinoma -2.400 0.000
adult high grade glioma -1.600 0.000
primary Sjogren syndrome 1.100 0.004
subependymal giant cell astrocytoma -1.550 0.031
lung carcinoma -1.500 0.000
ovarian cancer -2.800 0.000
Breast cancer 1.400 0.005
psoriasis 1.300 0.000

Synonym

Accession Q92563 C9J767 Q6UW87
Symbols testican-2

Gene

  Ortholog (14)

Gene RIF (5)

PMID Text
21836138 candidate susceptibility gene for bronchopulmonary dysplasia; lung expression pattern indicates potential role in alveolarization
18398821 Observational study of gene-disease association. (HuGE Navigator)
17950619 purification and characterization of a recombinant testican-2 expressed in insect cells; the C1q subcomponent of complement component C1 was identified as a potential interacting partner of testican-2
16385451 Observational study of gene-disease association. (HuGE Navigator)
12810672 Neurons are a major source of all of the testican family members in the normal brain. Abundant distribution of testican 2 may contribute to glioma invasion by inactivating other testican family members including N-Tes, which all inhibit MT-MMPs.

AA Sequence

MRAPGCGRLVLPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNRFRDEVEDDYI      1 - 70
KSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHRIKQPTVKLHGNKDSICKPCH     71 - 140
MAQLASVCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDR    141 - 210
LRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEV    211 - 280
CIRPFFNSCDTYKDGRVSTAEWCFCFWREKPPCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQ    281 - 350
SSGDCWCVDQLGLELTGTRTHGSPDCDDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDG    351 - 420
GYIW                                                                      421 - 424
//

Text Mined References (20)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
22832964 2012 Genome-wide meta-analyses of smoking behaviors in African Americans.
21836138 2011 Identification of SPOCK2 as a susceptibility gene for bronchopulmonary dysplasia.
21216879 2011 A genome-wide association study identifies novel loci associated with circulating IGF-I and IGFBP-3.
18398821 2008 Genome-wide analysis identifies 16q deletion associated with survival, molecular subtypes, mRNA expression, and germline haplotypes in breast cancer patients.
17950619 2008 Purification and characterization of a recombinant human testican-2 expressed in baculovirus-infected Sf9 insect cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...