Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.53
PubTator Score 9.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.373 0.001
ependymoma 1.100 0.029
oligodendroglioma 1.100 0.002
cutaneous lupus erythematosus 2.000 0.005
osteosarcoma -1.951 0.000
glioblastoma -1.400 0.000
group 3 medulloblastoma -2.100 0.000
astrocytoma 1.500 0.008
atypical teratoid/rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.600 0.025
adrenocortical carcinoma -2.018 0.000
tuberculosis -1.700 0.000
non-small cell lung cancer -2.580 0.000
lung cancer -2.000 0.000
interstitial cystitis 1.700 0.005
lung adenocarcinoma -2.400 0.000
adult high grade glioma -1.600 0.000
primary Sjogren syndrome 1.100 0.004
subependymal giant cell astrocytoma -1.550 0.031
lung carcinoma -1.500 0.000
ovarian cancer -2.800 0.000
Breast cancer 1.400 0.005
psoriasis 1.300 0.000

Gene RIF (5)

PMID Text
21836138 candidate susceptibility gene for bronchopulmonary dysplasia; lung expression pattern indicates potential role in alveolarization
18398821 Observational study of gene-disease association. (HuGE Navigator)
17950619 purification and characterization of a recombinant testican-2 expressed in insect cells; the C1q subcomponent of complement component C1 was identified as a potential interacting partner of testican-2
16385451 Observational study of gene-disease association. (HuGE Navigator)
12810672 Neurons are a major source of all of the testican family members in the normal brain. Abundant distribution of testican 2 may contribute to glioma invasion by inactivating other testican family members including N-Tes, which all inhibit MT-MMPs.

AA Sequence

MRAPGCGRLVLPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNRFRDEVEDDYI      1 - 70
KSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHRIKQPTVKLHGNKDSICKPCH     71 - 140
MAQLASVCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDR    141 - 210
LRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEV    211 - 280
CIRPFFNSCDTYKDGRVSTAEWCFCFWREKPPCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQ    281 - 350
SSGDCWCVDQLGLELTGTRTHGSPDCDDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDG    351 - 420
GYIW                                                                      421 - 424
//

Text Mined References (20)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
22832964 2012 Genome-wide meta-analyses of smoking behaviors in African Americans.
21836138 2011 Identification of SPOCK2 as a susceptibility gene for bronchopulmonary dysplasia.
21216879 2011 A genome-wide association study identifies novel loci associated with circulating IGF-I and IGFBP-3.
18398821 2008 Genome-wide analysis identifies 16q deletion associated with survival, molecular subtypes, mRNA expression, and germline haplotypes in breast cancer patients.
17950619 2008 Purification and characterization of a recombinant human testican-2 expressed in baculovirus-infected Sf9 insect cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...