Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.75
PubTator Score 9.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.075 1.0e-04
adult high grade glioma -1.600 8.6e-05
astrocytoma 1.500 7.9e-03
atypical teratoid / rhabdoid tumor -1.200 2.1e-06
Breast cancer 1.400 5.3e-03
Chronic Lymphocytic Leukemia 1.373 6.6e-04
cutaneous lupus erythematosus 1.200 1.4e-02
ependymoma 1.100 2.9e-02
glioblastoma -1.400 3.5e-04
group 3 medulloblastoma -1.300 3.8e-03
interstitial cystitis 1.700 5.1e-03
lung adenocarcinoma -1.900 6.9e-17
lung cancer 1.200 7.9e-03
lung carcinoma -1.500 1.2e-07
medulloblastoma, large-cell -2.600 5.6e-05
non-small cell lung cancer -1.133 1.0e-15
oligodendroglioma 1.100 1.7e-03
osteosarcoma -1.951 3.8e-05
ovarian cancer -2.800 4.5e-09
primary Sjogren syndrome 1.100 3.8e-03
primitive neuroectodermal tumor -1.600 2.5e-02
psoriasis 1.300 2.3e-44
subependymal giant cell astrocytoma -1.126 4.4e-02
tuberculosis -1.700 4.1e-07

Gene RIF (5)

AA Sequence

MRAPGCGRLVLPLLLLAAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNRFRDEVEDDYI      1 - 70
KSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHRIKQPTVKLHGNKDSICKPCH     71 - 140
MAQLASVCGSDGHTYSSVCKLEQQACLSSKQLAVRCEGPCPCPTEQAATSTADGKPETCTGQDLADLGDR    141 - 210
LRDWFQLLHENSKQNGSASSVAGPASGLDKSLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEV    211 - 280
CIRPFFNSCDTYKDGRVSTAEWCFCFWREKPPCLAELERIQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQ    281 - 350
SSGDCWCVDQLGLELTGTRTHGSPDCDDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDG    351 - 420
GYIW                                                                      421 - 424
//

Text Mined References (20)

PMID Year Title