Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.26
PubTator Score 2.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -2.662 5.3e-11
adult high grade glioma -3.600 1.6e-06
astrocytic glioma -2.600 4.7e-03
Astrocytoma, Pilocytic -2.700 2.0e-09
atypical teratoid / rhabdoid tumor -4.800 1.3e-15
cutaneous lupus erythematosus -2.200 6.1e-03
ependymoma -2.400 5.9e-03
glioblastoma -3.700 7.1e-12
group 3 medulloblastoma -4.500 7.7e-06
medulloblastoma, large-cell -4.000 9.7e-07
oligodendroglioma -1.700 2.6e-02
pituitary cancer -1.800 8.4e-08
primitive neuroectodermal tumor -3.800 5.6e-06
psoriasis -1.400 1.6e-09
subependymal giant cell astrocytoma -2.496 2.2e-02

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MELLSTPHSIEINNITCDSFRISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPM      1 - 70
TVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVF     71 - 140
YRNHHKEYFQHARTHCGNMLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPA    141 - 210
QRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSLGDRFCRDRLPLLDIACNKFLTCSVEDGELVFRHAQ    211 - 280
DLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR                        281 - 330
//

Text Mined References (9)

PMID Year Title