Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.22
PubTator Score 2.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.600 0.005
ependymoma -2.800 0.000
oligodendroglioma -2.500 0.000
psoriasis -2.700 0.000
cutaneous lupus erythematosus -2.200 0.006
glioblastoma -4.200 0.000
group 3 medulloblastoma -4.500 0.000
atypical teratoid / rhabdoid tumor -4.800 0.000
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -3.800 0.000
adrenocortical carcinoma -2.662 0.000
pediatric high grade glioma -3.900 0.000
pilocytic astrocytoma -2.700 0.000
subependymal giant cell astrocytoma -2.496 0.022
pituitary cancer -1.800 0.000

Synonym

Accession Q92561 D3DSR1 Q8N4I9
Symbols PAHX-AP
PAHXAP1
DYRK1AP3

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
15694837 PAHX-AP1 may contribute to new cellular functions of DYRK1A and suggest that PAHX-AP1 may be involved in the development of neurological abnormalities observed in Down syndrome patients

AA Sequence

MELLSTPHSIEINNITCDSFRISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPM      1 - 70
TVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVF     71 - 140
YRNHHKEYFQHARTHCGNMLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPA    141 - 210
QRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSLGDRFCRDRLPLLDIACNKFLTCSVEDGELVFRHAQ    211 - 280
DLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR                        281 - 330
//

Text Mined References (9)

PMID Year Title
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
15694837 2005 Dual-specificity tyrosine-phosphorylated and regulated kinase 1A (DYRK1A) interacts with the phytanoyl-CoA alpha-hydroxylase associated protein 1 (PAHX-AP1), a brain specific protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11245925 2001 Characterization of mouse brain-specific angiogenesis inhibitor 1 (BAI1) and phytanoyl-CoA alpha-hydroxylase-associated protein 1, a novel BAI1-binding protein.
10686344 2000 Identification of a brain specific protein that associates with a refsum disease gene product, phytanoyl-CoA alpha-hydroxylase.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.