Property Summary

NCBI Gene PubMed Count 178
PubMed Score 132.31
PubTator Score 226.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
lung cancer 4740 2.2e-02
subependymal giant cell astrocytoma 2287 4.0e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.826 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 2.2e-02
subependymal giant cell astrocytoma -1.414 4.0e-02

Gene RIF (152)

AA Sequence

MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTS      1 - 70
VIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKA     71 - 140
HNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVI    141 - 210
MERIGLATAGEPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQ    211 - 280
LPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNP    281 - 350
TPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSALRYKG    351 - 420
KGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSN    421 - 490
ESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTG    491 - 560
LLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPK    561 - 630
ELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRR    631 - 700
RQGVSIGRLHKQRKPDRRKRSRPYKAKRQ                                             701 - 729
//

Text Mined References (185)

PMID Year Title