Property Summary

NCBI Gene PubMed Count 66
PubMed Score 1145.86
PubTator Score 601.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.127 1.2e-03
adult high grade glioma -1.400 1.2e-02
astrocytic glioma -1.700 3.2e-03
atypical teratoid / rhabdoid tumor -1.900 9.2e-06
ependymoma -2.500 7.2e-03
glioblastoma -1.300 4.8e-04
intraductal papillary-mucinous adenoma (... -1.400 4.0e-04
intraductal papillary-mucinous carcinoma... -1.200 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.2e-02
invasive ductal carcinoma -1.033 1.9e-04
lung cancer 1.300 4.9e-03
lung carcinoma 1.300 5.6e-20
medulloblastoma -1.300 4.0e-06
non-small cell lung cancer 1.629 2.3e-14
oligodendroglioma -1.200 5.2e-13
osteosarcoma -1.026 3.7e-02
ovarian cancer -1.600 1.4e-05
primitive neuroectodermal tumor -1.200 4.7e-03
Rheumatoid arthritis 2.000 1.4e-02
subependymal giant cell astrocytoma -1.913 3.7e-02
tuberculosis 1.100 1.5e-03

Gene RIF (38)

AA Sequence

MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQ      1 - 70
ERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPY     71 - 140
RDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQG    141 - 210
PELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPP    211 - 280
PPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPP    281 - 350
PVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEV    351 - 420
QGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIPASEPKRHPST    421 - 490
LPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE     491 - 559
//

Text Mined References (69)

PMID Year Title