Property Summary

NCBI Gene PubMed Count 63
Grant Count 334
R01 Count 200
Funding $115,932,553.31
PubMed Score 1003.77
PubTator Score 601.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92558 E1P5F2 Q5SZK7 WASP family protein member 1
Symbols WAVE
SCAR1
WAVE1

Gene

PDB

3P8C   4N78  

 GO Function (1)

Gene RIF (36)

PMID Text
26977009 Results implicate a contributory role of WAVE1 and -3 to the metastatic phenotype of PC-3 cells through their interaction with the ARP2/3 complex.
26280122 A decrease in amounts of WASF1 mRNA was also observed in human Alzheimer's disease brains, suggesting clinical relevance of the negative feedback circuit involved in homeostatic regulation of Abeta production
25906751 we propose that WASF1 status defines a subtype of androgen deprivation therapy -resistant prostate cancer patients
25799492 a role for ARF6 in linking EGF-receptor signaling to Rac1 recruitment and activation at the plasma membrane to promote breast cancer cell directed migration
25745180 HIV-1-mediated effects on podosomes and migration involve Nef-HCK interaction, and HCK-mediated phosphorylation of WASP at podosomes
25527710 HIV-1-mediated effects on podosomes and migration involve Nef-HCK interaction, and HCK-mediated phosphorylation of WASP at podosomes
25473116 WAVE1 has unique activities independent of Arp2/3 complex that can govern both the growth rates and architectures of actin filament networks. Elongation inhibitory effects of WAVE1 were mapped to its WH2 ("V") domain.
25355952 The WAVE complex is the main activator of the Arp2/3 complex for actin filament nucleation and assembly in the lamellipodia of moving cells.
24819384 D620N mutation in VPS35 restricts WASH complex recruitment to endosomes, and reveals a novel role for the WASH complex in autophagosome formation.
23680521 WAVE1 might promote the proliferative and invasive malignant behaviors through the activation of the PI3K/AKT and p38MAPK signaling pathways in epithelial ovarian cancer.
More...

AA Sequence

MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAHSFSFRVNSLQ      1 - 70
ERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIPLQETYDVCEQPPPLNILTPY     71 - 140
RDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRPHEPEKVPRAPHDRRREWQKLAQG    141 - 210
PELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPP    211 - 280
PPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPP    281 - 350
PVPPPPPPPATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEV    351 - 420
QGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIPASEPKRHPST    421 - 490
LPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIAVEYSDSEDDSEFDEVDWLE     491 - 559
//

Text Mined References (66)

PMID Year Title
26977009 2016 The Association Between WAVE1 and -3 and the ARP2/3 Complex in PC 3 Cells.
26280122 2015 APP intracellular domain-WAVE1 pathway reduces amyloid-? production.
25906751 2015 Loss of Wave1 gene defines a subtype of lethal prostate cancer.
25799492 2015 ARF6 promotes the formation of Rac1 and WAVE-dependent ventral F-actin rosettes in breast cancer cells in response to epidermal growth factor.
25473116 2015 A novel role for WAVE1 in controlling actin network growth rate and architecture.
25416956 2014 A proteome-scale map of the human interactome network.
25355952 2015 WAVE binds Ena/VASP for enhanced Arp2/3 complex-based actin assembly.
24819384 2014 Mutation in VPS35 associated with Parkinson's disease impairs WASH complex association and inhibits autophagy.
24439377 2014 Local F-actin network links synapse formation and axon branching.
23680521 2013 WAVE1 gene silencing via RNA interference reduces ovarian cancer cell invasion, migration and proliferation.
More...