Property Summary

NCBI Gene PubMed Count 67
PubMed Score 45.37
PubTator Score 36.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.600 1.5e-05
Astrocytoma, Pilocytic -1.200 1.9e-04
atypical teratoid / rhabdoid tumor -3.000 4.5e-08
ependymoma -3.100 5.1e-19
glioblastoma -1.400 2.0e-04
group 3 medulloblastoma -2.700 1.7e-06
interstitial cystitis 1.500 9.0e-04
intraductal papillary-mucinous adenoma (... -1.100 7.5e-03
intraductal papillary-mucinous neoplasm ... -1.100 3.9e-02
lung adenocarcinoma -1.100 2.6e-11
lung cancer -1.900 2.4e-03
lung carcinoma 2.500 4.1e-42
malignant mesothelioma 1.300 1.0e-03
medulloblastoma, large-cell -2.600 1.1e-03
non-small cell lung cancer -1.225 3.1e-13
ovarian cancer 1.400 1.8e-07
Pick disease -1.400 3.5e-03
subependymal giant cell astrocytoma -2.571 2.2e-02
ulcerative colitis 1.300 1.9e-03

Protein-protein Interaction (11)

Gene RIF (46)

AA Sequence

MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFYITEKNRNEIK      1 - 70
NGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERY     71 - 140
QKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAFIKKIASFVNKSAIDISILQRSLAILESMVL    141 - 210
NSHDLYQKVAQEITIGQLIPHLQGSDQEIQTYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVI    211 - 280
RAQRAINNEMAHQLYVLQVLTFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKS    281 - 350
MYTRDYKKLGFINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL    351 - 420
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKVMQVVKEQVMR    421 - 490
ALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPEILELIKQQRLNRLVEGT    491 - 560
CFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGA    561 - 630
LKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLD    631 - 700
LENIQIPDAPPPIPKEPSNYDFVYDCN                                               701 - 727
//

Text Mined References (74)

PMID Year Title