Property Summary

NCBI Gene PubMed Count 66
PubMed Score 42.13
PubTator Score 36.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 1.97985528228374E-45
non-small cell lung carcinoma 413 4.22768963709142E-26
ependymoma 2514 5.08648473312437E-19
lung adenocarcinoma 2714 2.6446141341019E-11
atypical teratoid / rhabdoid tumor 4369 4.4679739940632E-8
ovarian cancer 8492 1.81745062626551E-7
group 3 medulloblastoma 2254 1.71270922045025E-6
lung cancer 4473 4.81395632217762E-6
pediatric high grade glioma 2712 1.15133845369154E-4
interstitial cystitis 2299 1.16408613232416E-4
glioblastoma 5572 1.21257450694244E-4
pilocytic astrocytoma 3086 1.50131041812371E-4
malignant mesothelioma 3163 0.00103449992776626
medulloblastoma, large-cell 6234 0.00112689084324149
ulcerative colitis 2087 0.00188117686645893
Pick disease 1893 0.00352060793774798
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00752739513228598
subependymal giant cell astrocytoma 2287 0.0223327140352353
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0394060989017822
Disease Target Count Z-score Confidence
Kidney disease 397 3.329 1.7

Expression

Synonym

Accession Q92556 A4D1X6 Q29R79 Q6ZTJ0 Q96PB0 Q9H0I1
Symbols CED12
CED-12
ELMO-1

Gene

PANTHER Protein Class (1)

PDB

2RQR   2VSZ   3A98  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (45)

PMID Text
26882976 Cdc27 is a novel binding partner of Elmo1.Cdc27-Elmo1 has a cellular role independent from the Elmo-Dock1-Rac signal module.
26205662 Src-mediated Y724 phosphorylation in ELMO1 plays a critical role for cell spreading via activation of Rac1, leading to promotion of cell migration.
25901943 ELMO1 is expressed in rheumatoid arthritis synovium, promotes cell migration and invasion, and regulates Rac1 activity, thereby mediating rheumatoid arthritis pathogenicity.
25586182 Thus, Elmo1 and Dock180 facilitate blood vessel formation by stabilization of the endothelium during angiogenesis.
25360637 high ELMO1 expression is an independent negative prognostic factor in normal karyotype (NK) acute myeloid leukemia.
25167351 There is a low frequency rate of the ancestral genotype for the ELMO1 polymorphism rs1345365 in mestizos from the western and southeastern regions of Mexico.
24928514 the present study characterized a novel Nck-1-ELMO1 interaction and defined a new role for Nck-1 in regulating Rac1 activity.
24821968 findings reveal a previously unknown, nonredundant role for Elmo1 in controlling Dock2 levels and Dock2-dependent T cell migration in primary lymphocytes.
24819662 High ELMO1 expression is associated with serous ovarian cancer.
24433479 For ELMO1 (+9170 G>A), the GG genotype frequency was higher in the diabetic versus control group, but there were no differences between diabetic patients with and without nephropathies.
More...

AA Sequence

MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFYITEKNRNEIK      1 - 70
NGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERY     71 - 140
QKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAFIKKIASFVNKSAIDISILQRSLAILESMVL    141 - 210
NSHDLYQKVAQEITIGQLIPHLQGSDQEIQTYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVI    211 - 280
RAQRAINNEMAHQLYVLQVLTFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKS    281 - 350
MYTRDYKKLGFINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL    351 - 420
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKVMQVVKEQVMR    421 - 490
ALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPEILELIKQQRLNRLVEGT    491 - 560
CFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGA    561 - 630
LKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLD    631 - 700
LENIQIPDAPPPIPKEPSNYDFVYDCN                                               701 - 727
//

Text Mined References (73)

PMID Year Title
26882976 2016 Identification of a novel protein interaction between Elmo1 and Cdc27.
26205662 2015 Tyr724 phosphorylation of ELMO1 by Src is involved in cell spreading and migration via Rac1 activation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25901943 2015 Integrative omics analysis of rheumatoid arthritis identifies non-obvious therapeutic targets.
25586182 2015 The bipartite rac1 Guanine nucleotide exchange factor engulfment and cell motility 1/dedicator of cytokinesis 180 (elmo1/dock180) protects endothelial cells from apoptosis in blood vessel development.
25416956 2014 A proteome-scale map of the human interactome network.
25360637 2014 ELMO1 is upregulated in AML CD34+ stem/progenitor cells, mediates chemotaxis and predicts poor prognosis in normal karyotype AML.
25167351 [Polymorphism g.37190613 G>A of the ELMO1 gene in the Mexican population: potential marker for clinical-surgical pathology].
24928514 2014 A novel interaction between the SH2 domain of signaling adaptor protein Nck-1 and the upstream regulator of the Rho family GTPase Rac1 engulfment and cell motility 1 (ELMO1) promotes Rac1 activation and cell motility.
24821968 2014 Essential role of Elmo1 in Dock2-dependent lymphocyte migration.
More...