Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.94
PubTator Score 2.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.100 0.004
osteosarcoma -1.383 0.000
pancreatic ductal adenocarcinoma liver m... -1.003 0.030
lung cancer 1.200 0.001
diabetes mellitus -1.100 0.003
ovarian cancer -1.600 0.000

Synonym

Accession Q92552 B4DRT2 Q6P1S1 MRP-S27
Symbols S27mt
MRP-S27

Gene

PDB

3J9M  

Gene RIF (2)

PMID Text
22841715 MRPS27 is required for mitochondrial protein synthesis
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAASIVRRGMLLARQVVLPQLSPAGKRYLLSSAYVDSHKWEAREKEHYCLADLASLMDKTFERKLPVSSL      1 - 70
TISRLIDNISSREEIDHAEYYLYKFRHSPNCWYLRNWTIHTWIRQCLKYDAQDKALYTLVNKVQYGIFPD     71 - 140
NFTFNLLMDSFIKKENYKDALSVVFEVMMQEAFEVPSTQLLSLYVLFHCLAKKTDFSWEEERNFGASLLL    141 - 210
PGLKQKNSVGFSSQLYGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREAL    211 - 280
DVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESE    281 - 350
GLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA          351 - 414
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22841715 2012 MRPS27 is a pentatricopeptide repeat domain protein required for the translation of mitochondrially encoded proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19103604 2009 hNOA1 interacts with complex I and DAP3 and regulates mitochondrial respiration and apoptosis.
17488105 2007 Detection and validation of non-synonymous coding SNPs from orthogonal analysis of shotgun proteomics data.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...