Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.94
PubTator Score 2.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.46214303695936E-6
osteosarcoma 7933 1.80796892438687E-4
lung cancer 4473 0.00107933202300297
diabetes mellitus 1663 0.00315778210690132
psoriasis 6685 0.00353605327426327
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0304946508484687

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.100 0.004
osteosarcoma -1.383 0.000
pancreatic ductal adenocarcinoma liver m... -1.003 0.030
lung cancer 1.200 0.001
diabetes mellitus -1.100 0.003
ovarian cancer -1.600 0.000

Synonym

Accession Q92552 B4DRT2 Q6P1S1 MRP-S27
Symbols S27mt
MRP-S27

Gene

PDB

3J9M  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
22841715 MRPS27 is required for mitochondrial protein synthesis
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAASIVRRGMLLARQVVLPQLSPAGKRYLLSSAYVDSHKWEAREKEHYCLADLASLMDKTFERKLPVSSL      1 - 70
TISRLIDNISSREEIDHAEYYLYKFRHSPNCWYLRNWTIHTWIRQCLKYDAQDKALYTLVNKVQYGIFPD     71 - 140
NFTFNLLMDSFIKKENYKDALSVVFEVMMQEAFEVPSTQLLSLYVLFHCLAKKTDFSWEEERNFGASLLL    141 - 210
PGLKQKNSVGFSSQLYGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREAL    211 - 280
DVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESE    281 - 350
GLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA          351 - 414
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22841715 2012 MRPS27 is a pentatricopeptide repeat domain protein required for the translation of mitochondrially encoded proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19103604 2009 hNOA1 interacts with complex I and DAP3 and regulates mitochondrial respiration and apoptosis.
17488105 2007 Detection and validation of non-synonymous coding SNPs from orthogonal analysis of shotgun proteomics data.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...