Property Summary

NCBI Gene PubMed Count 8
Grant Count 6
R01 Count 4
Funding $365,354
PubMed Score 0.00
PubTator Score 2.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Mammographic Density 8

Expression

Gene RIF (2)

PMID Text
23091056 Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.
18187620 Knockdown of RGP1 retrograde golgi transport homolog (RGP1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQP      1 - 70
DVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTI     71 - 140
GCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRS    141 - 210
LHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPS    211 - 280
VSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTW    281 - 350
TGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI                                 351 - 391
//

Text Mined References (10)

PMID Year Title
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
23091056 2012 Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.