Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 2.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92546 Q5TCV5
Symbols KIAA0258

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQP      1 - 70
DVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTI     71 - 140
GCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRS    141 - 210
LHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPS    211 - 280
VSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTW    281 - 350
TGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI                                 351 - 391
//

Text Mined References (10)

PMID Year Title