Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.58
PubTator Score 5.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 1.317 1.3e-04
Astrocytoma, Pilocytic 1.100 1.7e-04
atypical teratoid / rhabdoid tumor 1.500 7.3e-07
ependymoma 1.700 1.0e-03
glioblastoma 1.700 2.3e-06
medulloblastoma, large-cell 1.300 1.6e-04
Multiple myeloma 1.906 8.1e-04
non primary Sjogren syndrome sicca 1.300 1.7e-02
non-small cell lung cancer 1.142 2.9e-14
oligodendroglioma 1.800 5.3e-04
osteosarcoma 1.301 1.2e-03
pediatric high grade glioma 1.300 5.7e-05
Polycystic ovary syndrome -1.061 4.8e-02
psoriasis 1.100 9.4e-07

Synonym

Accession Q92544 B0QYT7 Q9NUA3
Symbols dJ836N17.2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MATAMDWLPWSLLLFSLMCETSAFYVPGVAPINFHQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKIT      1 - 70
YKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLCSQSNKPVTLTVEQSRLVAERITEDYYVHLIADNLPV     71 - 140
ATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVI    141 - 210
PQSIRLEDLKADEKSSCTLPEGTNSSPQEIDPTKENQLYFTYSVHWEESDIKWASRWDTYLTMSDVQIHW    211 - 280
FSIINSVVVVFFLSGILSMIIIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQYPMILSSLLGS    281 - 350
GIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAGRLYRTLKGHRWKKGAFCTATLY    351 - 420
PGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWFGISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQI    421 - 490
PEQRWYMNRFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQL    491 - 560
CAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEFIPSLLYFGYTALMVLSFWLLTGTIGFYAAYM    561 - 630
FVRKIYAAVKID                                                              631 - 642
//

Text Mined References (13)

PMID Year Title