Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.58
PubTator Score 5.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.906 0.001
ependymoma 1.700 0.001
oligodendroglioma 1.800 0.001
psoriasis 1.600 0.000
osteosarcoma 1.301 0.001
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.700 0.000
medulloblastoma, large-cell 1.300 0.000
adrenocortical carcinoma 1.317 0.000
non-small cell lung cancer 1.142 0.000
pediatric high grade glioma 1.300 0.000
pilocytic astrocytoma 1.100 0.000
non primary Sjogren syndrome sicca 1.300 0.017
Polycystic Ovary Syndrome -1.061 0.048

Synonym

Accession Q92544 B0QYT7 Q9NUA3
Symbols dJ836N17.2

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
25961573 TM9SF4 is a direct target of HIF-1alpha, down-regulated in leukemic cells by hypoxia and involved in cell adhesion.
25659576 Our study shows for the first time the important role of TM9SF4 in the aberrant constitutive activation of the V-ATPase, and the development of a malignant phenotype.
19893578 TM9SF4 is a new marker of malignancy, representing a potential new target for anti-tumour strategies with a specific role in tumour cannibalism and in the establishment of a metastatic phenotype.

AA Sequence

MATAMDWLPWSLLLFSLMCETSAFYVPGVAPINFHQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKIT      1 - 70
YKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLCSQSNKPVTLTVEQSRLVAERITEDYYVHLIADNLPV     71 - 140
ATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVI    141 - 210
PQSIRLEDLKADEKSSCTLPEGTNSSPQEIDPTKENQLYFTYSVHWEESDIKWASRWDTYLTMSDVQIHW    211 - 280
FSIINSVVVVFFLSGILSMIIIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQYPMILSSLLGS    281 - 350
GIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAGRLYRTLKGHRWKKGAFCTATLY    351 - 420
PGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWFGISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQI    421 - 490
PEQRWYMNRFVGILMAGILPFGAMFIELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQL    491 - 560
CAEDYRWWWRNFLVSGGSAFYVLVYAIFYFVNKLDIVEFIPSLLYFGYTALMVLSFWLLTGTIGFYAAYM    561 - 630
FVRKIYAAVKID                                                              631 - 642
//

Text Mined References (13)

PMID Year Title
25999474 2015 TM9 family proteins control surface targeting of glycine-rich transmembrane domains.
25961573 2015 Human TM9SF4 Is a New Gene Down-Regulated by Hypoxia and Involved in Cell Adhesion of Leukemic Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25659576 2015 TM9SF4 is a novel V-ATPase-interacting protein that modulates tumor pH alterations associated with drug resistance and invasiveness of colon cancer cells.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
19893578 2009 The human homologue of Dictyostelium discoideum phg1A is expressed by human metastatic melanoma cells.
18088087 2008 Phosphoproteome of resting human platelets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...