Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
Funding $47,274.29
PubMed Score 3.15
PubTator Score 3.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q92543 E9PKB9 Q8IV55
Symbols CHET8

Gene

PANTHER Protein Class (2)

 Grant Application (1)

Gene RIF (5)

PMID Text
19752551 Observational study of gene-disease association. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18073581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKTETVPPFQETPAGSSCHLNNLLSSRKLMAVGVLLGWLLVIHLLVNVWLLCLLSALLVVLGGWLGSSLA      1 - 70
GVASGRLHLERFIPLATCPPCPEAERQLEREINRTIQMIIRDFVLSWYRSVSQEPAFEEEMEAAMKGLVQ     71 - 140
ELRRRMSVMDSHAVAQSVLTLCGCHLQSYIQAKEATAGKNGPVEPSHLWEAYCRATAPHPAVHSPSAEVT    141 - 210
YTRGVVNLLLQGLVPKPHLETRTGRHVVVELITCNVILPLISRLSDPDWIHLVLVGIFSKARDPAPCPAS    211 - 280
APEQPSVPTSLPLIAEVEQLPEGRASPVAAPVFLSYSEPEGSAGPSPEVEEGHEAVEGDLGGMCEERKVG    281 - 350
NNSSHFLQPNVRGPLFLCEDSELESPLSELGKETIMLMTPGSFLSDRIQDALCALESSQALEPKDGEASE    351 - 420
GAEAEEGPGTETETGLPVSTLNSCPEIHIDTADKEIEQGDVTASVTALLEGPEKTCPSRPSCLEKDLTND    421 - 490
VSSLDPTLPPVLLSSSPPGPLSSATFSFEPLSSPDGPVIIQNLRITGTITAREHSGTGFHPYTLYTVKYE    491 - 560
TALDGENSSGLQQLAYHTVNRRYREFLNLQTRLEEKPDLRKFIKNVKGPKKLFPDLPLGNMDSDRVEARK    561 - 630
SLLESFLKQLCAIPEIANSEEVQEFLALNTDARIAFVKKPFMVSRIDKMVVSAIVDTLKTAFPRSEPQSP    631 - 700
TEELSEAETESKPQTEGKKASKSRLRFSSSKISPALSVTEAQDKILYCLQEGNVESETLSMSAMESFIEK    701 - 770
QTKLLEMQPTKAPEKDPEQPPKGRVDSCVSDAAVPAQDPSNSDPGTETELADTALDLLLLLLTEQWKWLC    771 - 840
TENMQKFLRLIFGTLVQRWLEVQVANLTSPQRWVQYLLLLQESIWPGGVLPKFPRPVRTQEQKLAAEKQA    841 - 910
LQSLMGVLPDLVVEILGVNKCRLSWGLVLESLQQPLINRHLIYCLGDIILEFLDLSASVEESAATTSASD    911 - 980
TPGNSKRMGVSS                                                              981 - 992
//

Text Mined References (19)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24843546 2012 Sorting nexin 19 regulates the number of dense core vesicles in pancreatic ?-cells.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
19877062 2009 Screening of chondrogenic factors with a real-time fluorescence-monitoring cell line ATDC5-C2ER: identification of sorting nexin 19 as a novel factor.
19752551 2009 Polymorphisms associated with both noncardioembolic stroke and coronary heart disease: vienna stroke registry.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18073581 2007 Five common gene variants identify elevated genetic risk for coronary heart disease.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
More...