Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.06
PubTator Score 3.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.9e-04
COPD -1.200 9.1e-03
cystic fibrosis 1.078 1.7e-04
glioblastoma 1.400 6.0e-04
intraductal papillary-mucinous adenoma (... 1.400 6.9e-04
intraductal papillary-mucinous carcinoma... 1.200 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.100 7.7e-03
medulloblastoma, large-cell 1.400 3.9e-05
oligodendroglioma 1.200 2.8e-02
osteosarcoma -1.607 7.8e-05
ovarian cancer 1.100 4.4e-07
Pick disease 1.300 5.5e-06
psoriasis 1.300 1.2e-03

Gene RIF (5)

AA Sequence

MKTETVPPFQETPAGSSCHLNNLLSSRKLMAVGVLLGWLLVIHLLVNVWLLCLLSALLVVLGGWLGSSLA      1 - 70
GVASGRLHLERFIPLATCPPCPEAERQLEREINRTIQMIIRDFVLSWYRSVSQEPAFEEEMEAAMKGLVQ     71 - 140
ELRRRMSVMDSHAVAQSVLTLCGCHLQSYIQAKEATAGKNGPVEPSHLWEAYCRATAPHPAVHSPSAEVT    141 - 210
YTRGVVNLLLQGLVPKPHLETRTGRHVVVELITCNVILPLISRLSDPDWIHLVLVGIFSKARDPAPCPAS    211 - 280
APEQPSVPTSLPLIAEVEQLPEGRASPVAAPVFLSYSEPEGSAGPSPEVEEGHEAVEGDLGGMCEERKVG    281 - 350
NNSSHFLQPNVRGPLFLCEDSELESPLSELGKETIMLMTPGSFLSDRIQDALCALESSQALEPKDGEASE    351 - 420
GAEAEEGPGTETETGLPVSTLNSCPEIHIDTADKEIEQGDVTASVTALLEGPEKTCPSRPSCLEKDLTND    421 - 490
VSSLDPTLPPVLLSSSPPGPLSSATFSFEPLSSPDGPVIIQNLRITGTITAREHSGTGFHPYTLYTVKYE    491 - 560
TALDGENSSGLQQLAYHTVNRRYREFLNLQTRLEEKPDLRKFIKNVKGPKKLFPDLPLGNMDSDRVEARK    561 - 630
SLLESFLKQLCAIPEIANSEEVQEFLALNTDARIAFVKKPFMVSRIDKMVVSAIVDTLKTAFPRSEPQSP    631 - 700
TEELSEAETESKPQTEGKKASKSRLRFSSSKISPALSVTEAQDKILYCLQEGNVESETLSMSAMESFIEK    701 - 770
QTKLLEMQPTKAPEKDPEQPPKGRVDSCVSDAAVPAQDPSNSDPGTETELADTALDLLLLLLTEQWKWLC    771 - 840
TENMQKFLRLIFGTLVQRWLEVQVANLTSPQRWVQYLLLLQESIWPGGVLPKFPRPVRTQEQKLAAEKQA    841 - 910
LQSLMGVLPDLVVEILGVNKCRLSWGLVLESLQQPLINRHLIYCLGDIILEFLDLSASVEESAATTSASD    911 - 980
TPGNSKRMGVSS                                                              981 - 992
//

Text Mined References (19)

PMID Year Title