Property Summary

NCBI Gene PubMed Count 113
Grant Count 144
R01 Count 96
Funding $11,986,666.01
PubMed Score 143.42
PubTator Score 114.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.500 0.003
oligodendroglioma 1.300 0.001
osteosarcoma 1.129 0.000
astrocytoma 1.800 0.001
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.200 0.002
primitive neuroectodermal tumor 1.100 0.000
pediatric high grade glioma 1.100 0.000
pilocytic astrocytoma 1.100 0.000

Synonym

Accession Q92542 Q5T207 Q5T208 Q86VV5
Symbols ATAG1874

Gene

PDB

5A63   5FN2   5FN3   5FN4   5FN5   4UIS   2N7Q   2N7R   4UPC  

 GO Function (1)

Gene RIF (83)

PMID Text
26887941 The "Lid" domain of nicastrin is not essential for regulating gamma-secretase activity.
26280335 atomic structure of human gamma-secretase at 3.4 A resolution, determined by single-particle cryo-electron microscopy
26224166 haploinsufficiency of the NCSTN gene caused by the nonsense mutation c.1258C>T (p.Q420X) contributes to the occurrence of hidradenitis suppurativa in this family.
26067312 Tumor necrosis factor-alpha and interleukin-10 levels were elevated in acne inversa patients with nicastrin or presenilin enhancer mutation.
25996556 Akt1 phosphorylates NCT at Ser437, significantly reducing NCT stability. A phospho-deficient mutation in NCT at Ser437 stabilized its protein levels.
25953768 SNPs in Notch pathway genes may be predictors of cutaneous melanoma disease-specific survival.
25918421 analysis of how the conformation of presenilin, Pen-2, Aph-1, and nicastrin affect the function and mechanism of gamma-secretase
25863267 A strategy focused on MAPT, APP, NCSTN and BACE1 to build blood classifiers for Alzheimer's disease.
25693063 We suggest that this is the first description of an NCSTN nonsense mutation causing autosomal dominant hidradenitis suppurativa in an African American family.
25248409 High nicastrin expression is associated with invasive breast cancer.
More...

AA Sequence

MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDT      1 - 70
GVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQC     71 - 140
PNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTF    141 - 210
PLCAMQLFSHMHAVISTATCMRRSSIQSTFSINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAAT    211 - 280
RLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKG    281 - 350
KFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQ    351 - 420
PLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADV    421 - 490
ATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP    491 - 560
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARA    561 - 630
LSPAFELSQWSSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIA    631 - 700
PREPGAVSY                                                                 701 - 709
//

Text Mined References (120)

PMID Year Title
26887941 2016 Evidence That the "Lid" Domain of Nicastrin Is Not Essential for Regulating ?-Secretase Activity.
26280335 2015 An atomic structure of human ?-secretase.
26224166 2015 Haploinsufficiency caused by a nonsense mutation in NCSTN underlying hidradenitis suppurativa in a Chinese family.
26067312 2015 ?-Secretase Mutation and Consequently Immune Reaction Involved in Pathogenesis of Acne Inversa.
25996556 2015 Akt1 phosphorylates Nicastrin to regulate its protein stability and activity.
25953768 2015 Functional Variants in Notch Pathway Genes NCOR2, NCSTN, and MAML2 Predict Survival of Patients with Cutaneous Melanoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25918421 2015 Structural basis of human ?-secretase assembly.
25863267 2015 A strategy focused on MAPT, APP, NCSTN and BACE1 to build blood classifiers for Alzheimer's disease.
25693063 2015 ?-Secretase Mutation in an African American Family With Hidradenitis Suppurativa.
More...