Property Summary

NCBI Gene PubMed Count 17
PubMed Score 25.59
PubTator Score 10.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -1.600 0.000
osteosarcoma -1.250 0.009
Amyotrophic Lateral Sclerosis 1.367 0.000
acute quadriplegic myopathy 2.622 0.000
colon cancer 1.200 0.001
lung cancer 1.500 0.002
Breast cancer 2.300 0.039
interstitial cystitis 1.200 0.001
atypical teratoid/rhabdoid tumor 1.100 0.018

Synonym

Accession Q92536 Q68DS4 Q7L1N3
Symbols LAT3
LAT-2
y+LAT-2

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
24142711 Results suggest that leukemia cell proliferation can be significantly suppressed by blocking amino acid transporter LAT3.
24052624 Inhibition of LAT transporters may provide a novel therapeutic target in metastatic castration-resistant prostate cancer, via suppression of mammalian target of rapamycin complex 1 activity and M-phase cell cycle genes.
23221699 L-theanine is transported mostly via the system L transport pathway and its isoforms
22007000 Data show that signaling via the androgen receptor and ATF4 pathways regulates expression of the amino acid transporters LAT1 and LAT3, thereby coordinating their increased expression in prostate cancer cells.
19443642 LAT3 may play a crucial role in the development and maintenance of podocyte structure and function by regulating protein synthesis and the actin cytoskeleton.

AA Sequence

MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGV      1 - 70
LVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQ     71 - 140
AIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMG    141 - 210
LVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTL    211 - 280
IYILTNVAYYTVLNISDVLSSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREG    281 - 350
HLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPR    351 - 420
PLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRG    421 - 490
TQQLCFCVLTELDVAEEKKDERKTD                                                 491 - 515
//

Text Mined References (28)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24142711 2013 Suppression of amino acid transporter LAT3 expression on proliferation of K562 cells.
24052624 2013 Targeting amino acid transport in metastatic castration-resistant prostate cancer: effects on cell cycle, cell growth, and tumor development.
23221699 2012 The involvement of L-type amino acid transporters in theanine transport.
22007000 2011 Androgen receptor and nutrient signaling pathways coordinate the demand for increased amino acid transport during prostate cancer progression.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
19443642 2009 Amino acid transporter LAT3 is required for podocyte development and function.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...