Property Summary

NCBI Gene PubMed Count 17
PubMed Score 28.59
PubTator Score 10.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.563 2.4e-06
Amyotrophic lateral sclerosis 1.140 1.2e-06
atypical teratoid/rhabdoid tumor 1.100 1.8e-02
Breast cancer 2.300 3.9e-02
colon cancer 1.200 6.1e-04
interstitial cystitis 1.200 6.0e-04
lung cancer 1.500 2.2e-03
malignant mesothelioma 1.100 2.8e-06
osteosarcoma -1.250 9.3e-03
psoriasis -1.500 2.5e-04

Gene RIF (5)

AA Sequence

MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGV      1 - 70
LVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQ     71 - 140
AIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMG    141 - 210
LVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTL    211 - 280
IYILTNVAYYTVLNISDVLSSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREG    281 - 350
HLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPR    351 - 420
PLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRG    421 - 490
TQQLCFCVLTELDVAEEKKDERKTD                                                 491 - 515
//

Text Mined References (28)

PMID Year Title