Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
R01 Count 4
Funding $1,502,089
PubMed Score 37.26
PubTator Score 14.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus -1.300 0.009
psoriasis -2.300 0.000
osteosarcoma -3.220 0.000
lung cancer 1.500 0.000
group 3 medulloblastoma 1.200 0.001
ovarian cancer 1.200 0.013

Synonym

Accession Q92535 O14491
Symbols GPI2

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
23670221 Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVV      1 - 70
IWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADLKSALVFITFTYGFSPVLKTL     71 - 140
TESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIF    141 - 210
ALWPMLQKKLKACTPRSYVGVTLLFAFSAVGGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIH    211 - 280
GPWDEAEIKEDLSRFLS                                                         281 - 297
//

Text Mined References (13)

PMID Year Title
23670221 2014 Fat depot-specific mRNA expression of novel loci associated with waist-hip ratio.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12655644 2003 Enzymes and auxiliary factors for GPI lipid anchor biosynthesis and post-translational transfer to proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11102867 2000 Dissecting and manipulating the pathway for glycosylphos-phatidylinositol-anchor biosynthesis.
10944123 2000 Initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-P and is regulated by DPM2.
9463366 1998 The first step of glycosylphosphatidylinositol biosynthesis is mediated by a complex of PIG-A, PIG-H, PIG-C and GPI1.
9325057 1997 Structures and chromosomal localizations of the glycosylphosphatidylinositol synthesis gene PIGC and its pseudogene PIGCP1.
More...