Property Summary

NCBI Gene PubMed Count 14
PubMed Score 41.26
PubTator Score 14.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 1.3e-04
osteosarcoma 7950 1.5e-04
group 3 medulloblastoma 4104 9.8e-04
lung cancer 4740 1.7e-03
cutaneous lupus erythematosus 1057 9.5e-03
ovarian cancer 8520 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Obesity 678 0.0 3.0
Disease Target Count Z-score Confidence
Lassa fever 9 3.56 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus -1.300 9.5e-03
group 3 medulloblastoma 1.200 9.8e-04
lung cancer 1.400 1.7e-03
osteosarcoma -3.220 1.5e-04
ovarian cancer 1.200 1.3e-02
psoriasis -2.300 1.3e-04

Gene RIF (3)

AA Sequence

MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVV      1 - 70
IWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADLKSALVFITFTYGFSPVLKTL     71 - 140
TESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIF    141 - 210
ALWPMLQKKLKACTPRSYVGVTLLFAFSAVGGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIH    211 - 280
GPWDEAEIKEDLSRFLS                                                         281 - 297
//

Text Mined References (14)

PMID Year Title