Property Summary

NCBI Gene PubMed Count 45
Grant Count 11
R01 Count 8
Funding $1,383,371.46
PubMed Score 21.13
PubTator Score 11.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.200 0.012
osteosarcoma -3.476 0.000
posterior fossa group A ependymoma 1.400 0.000
astrocytoma 2.000 0.001
lung cancer 1.100 0.009
ovarian cancer 1.400 0.000
dermatomyositis 1.500 0.001

 MGI Term (1)

Gene RIF (35)

PMID Text
24770418 cellular roles and mechanisms of PI31 in regulation of proteasome function remain unclear and require future definition.
18495667 a model for FP domain-mediated dimerization of SCF(Fbxo7) and PI31
16146763 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
16046164 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
16035254 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
15638724 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
15183343 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
15139295 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14614829 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
14564014 Proteasomal degradation of HIV-1 integrase in mammalian cells occurs by the N-end rule pathway
More...

AA Sequence

MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYE      1 - 70
YKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIIT     71 - 140
PIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIV    141 - 210
DPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL             211 - 271
//

Text Mined References (55)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24770418 2014 Molecular and cellular roles of PI31 (PSMF1) protein in regulation of proteasome function.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...