Property Summary

NCBI Gene PubMed Count 46
PubMed Score 21.46
PubTator Score 11.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 8.7e-10
ovarian cancer 8520 1.6e-04
dermatomyositis 966 8.5e-04
astrocytoma 1146 8.9e-04
osteosarcoma 7950 2.6e-03
lung cancer 4740 9.5e-03
glioblastoma 5792 1.2e-02
Disease Target Count Z-score Confidence
Herpangina 9 4.682 2.3
hand, foot and mouth disease 13 3.488 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 2.000 8.9e-04
dermatomyositis 1.500 8.5e-04
ependymoma 1.200 8.7e-10
glioblastoma 1.200 1.2e-02
lung cancer 1.100 9.5e-03
osteosarcoma -1.783 2.6e-03
ovarian cancer 1.400 1.6e-04

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (32)

AA Sequence

MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYE      1 - 70
YKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIIT     71 - 140
PIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIV    141 - 210
DPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL             211 - 271
//

Text Mined References (56)

PMID Year Title