Property Summary

NCBI Gene PubMed Count 32
Grant Count 13
Funding $3,681,390
PubMed Score 88.54
PubTator Score 34.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -5.100 0.000
astrocytic glioma -3.200 0.004
ependymoma -3.500 0.023
glioblastoma -1.700 0.049
osteosarcoma 1.103 0.000
medulloblastoma -3.800 0.000
cystic fibrosis 3.129 0.000
medulloblastoma, large-cell -5.000 0.000
primitive neuroectodermal tumor -2.500 0.028
adrenocortical carcinoma -2.350 0.001
non-small cell lung cancer -1.687 0.000
intraductal papillary-mucinous adenoma (... -1.700 0.003
intraductal papillary-mucinous carcinoma... -1.400 0.045
lung cancer -1.200 0.001
lung adenocarcinoma -1.200 0.000
adult high grade glioma -1.400 0.049
lung carcinoma -1.600 0.000
progressive supranuclear palsy 1.200 0.014
invasive ductal carcinoma -1.400 0.021
pituitary cancer 1.500 0.019

Gene RIF (17)

PMID Text
25062668 High SHC3 expression is associated with glioblastoma.
22311806 Rai (ShcC/N-Shc), a member of the family of Shc-like adaptor proteins, as a new regulator of migration of normal and cancer stem/progenitor cells.
21046104 Polymorphism in RAI and CD3EAP are associated with outcome of myeloma patients treated with high dose treatment.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19748727 amplification of SHC3 and EDG3 genes suggests that the two proteins co-operate and are important for ependymomas in vivo.
18997821 ShcC is a therapeutic target that might induce differentiation in the aggressive type of neuroblastomas.
17919311 shcc is expressed in the human gut, especially in the enteric glial cells
17179996 Observational study of gene-disease association. (HuGE Navigator)
17179996 11 SNPs within SHC3 were examined to determine the association with nicotine dependence (ND) in either African-Americans (AA) or European-Americans (EA); three SNPs for AAs and one for EAs were significantly associated with at least one ND.
16436505 HIV-1 Tat-induced small GTPase Ras activation is mediated by tyrosine phosphorylation of Shc and recruitment of Grb2 in human endothelial cells
More...

AA Sequence

MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDGPGSLGHLLHK      1 - 70
VSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPSAPRAPAMSAARKGRPGDEPLPRPPRG     71 - 140
APHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAISRVCEAVPGAKGAFKKRKPPSKMLS    141 - 210
SILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRAC    211 - 280
HILECCDGLAQDVIGSIGQAFELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKMP    281 - 350
PPGGFLDTRLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGE    351 - 420
APTYVNTQQIPPQAWPAAVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVECISPVSPRAPDAKM    421 - 490
LEELQAETWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGMHNGQAKHLLLVDPEGTIRTKDRVF    491 - 560
DSISHLINHHLESSLPIVSAGSELCLQQPVERKQ                                        561 - 594
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25062668 2014 Cell density modulates SHC3 expression and survival of human glioblastoma cells through Fak activation.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
22331829 2012 Genetic determinants of statin-induced low-density lipoprotein cholesterol reduction: the Justification for the Use of Statins in Prevention: an Intervention Trial Evaluating Rosuvastatin (JUPITER) trial.
22311806 2012 Rai is a new regulator of neural progenitor migration and glioblastoma invasion.
21046104 2011 The importance of a sub-region on chromosome 19q13.3 for prognosis of multiple myeloma patients after high-dose treatment and stem cell support: a linkage disequilibrium mapping in RAI and CD3EAP.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19748727 2010 EDG3 and SHC3 on chromosome 9q22 are co-amplified in human ependymomas.
18997821 2009 Distinct role of ShcC docking protein in the differentiation of neuroblastoma.
17919311 2008 Expression of the Rai (Shc C) adaptor protein in the human enteric nervous system.
More...