Property Summary

NCBI Gene PubMed Count 33
PubMed Score 99.41
PubTator Score 34.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.078 2.2e-03
adult high grade glioma -1.400 4.9e-02
astrocytic glioma -1.200 1.4e-02
cystic fibrosis 1.136 2.4e-05
ependymoma -3.500 2.3e-02
glioblastoma -1.500 2.5e-02
group 3 medulloblastoma -1.900 6.1e-03
intraductal papillary-mucinous adenoma (... -1.700 3.1e-03
intraductal papillary-mucinous carcinoma... -1.400 4.5e-02
invasive ductal carcinoma -1.400 2.1e-02
lung adenocarcinoma -1.200 5.0e-09
lung cancer -1.200 7.6e-04
lung carcinoma -1.600 3.8e-14
malignant mesothelioma -5.100 2.1e-09
medulloblastoma, large-cell -2.100 1.4e-03
non-small cell lung cancer -1.687 6.1e-20
osteosarcoma 1.103 3.3e-05
pituitary cancer 1.500 1.9e-02
primitive neuroectodermal tumor -2.500 2.8e-02
progressive supranuclear palsy 1.200 1.4e-02

Synonym

Accession Q92529 Q5T7I7 Q8TAP2 Q9UCX5
Symbols RAI
NSHC
SHCC
N-Shc

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

 MGI Phenotype (1)

Gene RIF (17)

AA Sequence

MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDGPGSLGHLLHK      1 - 70
VSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPSAPRAPAMSAARKGRPGDEPLPRPPRG     71 - 140
APHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAISRVCEAVPGAKGAFKKRKPPSKMLS    141 - 210
SILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRAC    211 - 280
HILECCDGLAQDVIGSIGQAFELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKMP    281 - 350
PPGGFLDTRLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGE    351 - 420
APTYVNTQQIPPQAWPAAVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVECISPVSPRAPDAKM    421 - 490
LEELQAETWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGMHNGQAKHLLLVDPEGTIRTKDRVF    491 - 560
DSISHLINHHLESSLPIVSAGSELCLQQPVERKQ                                        561 - 594
//

Text Mined References (34)

PMID Year Title