Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.84
PubTator Score 2.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -2.100 0.000

Gene RIF (1)

PMID Text
22613542 evidence suggests that ANKRD7 and CYTL1 genes may play an important role in the variance in alcohol drinking risk

AA Sequence

MNKLFSFWKRKNETRSQGYNLREKDLKKLHRAASVGDLKKLKEYLQIKKYDVNMQDKKYRTPLHLACANG      1 - 70
HTDVVLFLIEQQCKINVRDSENKSPLIKAVQCQNEDCATILLNFGADPDLRDIRYNTVLHYAVCGQSLSL     71 - 140
VEKLLEYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTALILAVSGEPPCLVKLL    141 - 210
LQQGVELCYEGIVDSQLRNMFISMVLLHRYPQFTASHGKKKHAK                              211 - 254
//

Text Mined References (8)

PMID Year Title
22613542 2012 ANKRD7 and CYTL1 are novel risk genes for alcohol drinking behavior.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.
8812458 1996 Isolation of three testis-specific genes (TSA303, TSA806, TSA903) by a differential mRNA display method.