Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.84
PubTator Score 2.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Alcoholic Intoxication, Chronic 289
Disease Target Count P-value
malignant mesothelioma 3232 3.2e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 2.1
substance-related disorder 162 0.0 1.0

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -2.100 3.2e-08

Gene RIF (1)

AA Sequence

MNKLFSFWKRKNETRSQGYNLREKDLKKLHRAASVGDLKKLKEYLQIKKYDVNMQDKKYRTPLHLACANG      1 - 70
HTDVVLFLIEQQCKINVRDSENKSPLIKAVQCQNEDCATILLNFGADPDLRDIRYNTVLHYAVCGQSLSL     71 - 140
VEKLLEYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTALILAVSGEPPCLVKLL    141 - 210
LQQGVELCYEGIVDSQLRNMFISMVLLHRYPQFTASHGKKKHAK                              211 - 254
//

Text Mined References (8)

PMID Year Title