Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.85
PubTator Score 1.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 0.006
osteosarcoma -1.810 0.000
posterior fossa group B ependymoma 1.900 0.000
lung cancer -1.200 0.040
group 3 medulloblastoma 1.100 0.001
Breast cancer -1.400 0.000

Gene RIF (2)

PMID Text
16415341 antagonistic actions of PhLP3 and prefoldin serve to modulate CCT activity and play a key role in establishing a functional cytoskeleton in vivo
9013858 Describes the cloning of a very similar protein in mouse.

AA Sequence

MAAIKAVNSKAEVARARAALAVNICAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLDEMQIQ      1 - 70
HPTASLIAKVATAQDDVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAKIKALEVLEEVKVT     71 - 140
KEMKRKILLDVARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKLGTDTKLIQGL    141 - 210
VLDHGARHPDMKKRVEDAFILICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDK    211 - 280
VCAQSNKGFVVINQKGIDPFSLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLTVDCLGHAGLV    281 - 350
YEYTLGEEKFTFIEECVNPCSVTLLVKGPNKHTLTQVKDAIRDGLRAIKNAIEDGCMVPGAGAIEVAMAE    351 - 420
ALVTYKNSIKGRARLGVQAFADALLIIPKVLAQNAGYDPQETLVKVQAEHVESKQLVGVDLNTGEPMVAA    421 - 490
DAGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK                                  491 - 530
//

Text Mined References (13)

PMID Year Title
23143597 2012 The genetic landscape of mutations in Burkitt lymphoma.
21269460 2011 Initial characterization of the human central proteome.
20193073 2010 Chaperonin genes on the rise: new divergent classes and intense duplication in human and other vertebrate genomes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16415341 2006 PhLP3 modulates CCT-mediated actin and tubulin folding via ternary complexes with substrates.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...