Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
Funding $139,004.5
PubMed Score 48.07
PubTator Score 12.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q92522
Symbols H1X
H1.10

Gene

 Grant Application (1)

PDB

2LSO  

Gene RIF (3)

PMID Text
19108733 study concludes that the high expression of histone H1x in neuroendocrine tumours is probably due to the abundance of this protein in the cells from which these tumours originate
17868027 These results suggest that the differential localization of H1x provides a mechanism for a control of H1x activity by means of shuttling between nuclear subcompartments instead of a controlled turnover of the protein.
16006241 comparison of primary aa sequence with other human H1 subtypes, and H1x from different species, generation of specific antibody, expression in different cell lines

AA Sequence

MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKI      1 - 70
YTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPT     71 - 140
AHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPK    141 - 210
GRK                                                                       211 - 213
//

Text Mined References (28)

PMID Year Title
26689747 2016 Role of H1 linker histones in mammalian development and stem cell differentiation.
25645921 2015 Genome distribution of replication-independent histone H1 variants shows H1.0 associated with nucleolar domains and H1X associated with RNA polymerase II-enriched regions.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24614311 2014 Every amino acid matters: essential contributions of histone variants to mammalian development and disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...