Property Summary

NCBI Gene PubMed Count 17
PubMed Score 52.82
PubTator Score 12.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.227 4.1e-02
group 4 medulloblastoma 1.100 1.9e-03
hereditary spastic paraplegia 1.015 1.2e-02
malignant mesothelioma 1.600 4.9e-07
Multiple myeloma 1.747 5.5e-04
ovarian cancer 2.300 4.8e-05
subependymal giant cell astrocytoma -1.205 1.7e-03
tuberculosis 1.300 2.3e-04

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKI      1 - 70
YTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPT     71 - 140
AHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPK    141 - 210
GRK                                                                       211 - 213
//

Text Mined References (29)

PMID Year Title