Property Summary

NCBI Gene PubMed Count 30
PubMed Score 60.82
PubTator Score 13.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.259 8.5e-03
active ulcerative colitis 1.058 2.0e-02
Amyotrophic lateral sclerosis 1.010 4.9e-05
autosomal dominant Emery-Dreifuss muscul... 1.336 5.2e-03
chronic lymphosyte leukemia 1.100 2.7e-03
Duchenne muscular dystrophy 1.392 9.6e-07
hereditary spastic paraplegia -1.102 7.8e-03
juvenile dermatomyositis 1.123 1.1e-07
medulloblastoma, large-cell -1.300 9.5e-04
Multiple myeloma 1.239 6.4e-03
osteosarcoma 1.389 1.3e-03
ovarian cancer -1.400 1.1e-02
Pick disease -1.100 1.6e-02
pituitary cancer -1.100 7.8e-05
Waldenstrons macroglobulinemia -1.832 3.4e-02

Gene RIF (15)

AA Sequence

MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFA      1 - 70
FKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQ     71 - 140
DGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYE    141 - 210
GWPEVVEMEGCIPQKQD                                                         211 - 227
//

Text Mined References (35)

PMID Year Title