Property Summary

NCBI Gene PubMed Count 51
Grant Count 45
R01 Count 7
Funding $6,129,443.24
PubMed Score 32.73
PubTator Score 37.49

Knowledge Summary

Patent (4,903)

Expression

Gene RIF (34)

PMID Text
26517934 Studies show a remarkable reduction in tribbles 2 protein (Trib2) expression during oocyte maturation whereas tribbles 1 protein (Trib1) and tribbles 3 protein (Trib3) expression was significantly increased during this process.
26517933 Studies show that TRIB1 and TRIB2 are highly expressed in molecularly-defined sub-types of acute myeloid leukemia (AML).
26517930 Studies indicate that small molecules can reveal rate-limiting signalling outputs and functions of pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 in cells and intact organisms, serving as guides for the development of new drugs.
26517929 Studies indicate that the molecular interactions that take place between tribbles homolog 2 (Drosophila) protein (TRIB2) and factors involved in the ubiquitin proteasome system (UPS) are varied and have differential downstream effects.
26517928 Studies suggest that tribbles homolog 2 (Drosophila) protein (TRIB2) as a meaningful biomarker to both diagnose and stage melanoma.
26517925 Studies suggest that pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 were involved in the pathogenesis of inflammation.
26517922 Studies suggest that pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 play roles in pathogenesis of rheumatoid arthritis (RA) and osteoarthritis.
26202930 High TRIB2 reinforces the oncogenic transcriptional program controlled by the TAL1 complex in T-cell acute lymphoblastic leukemia.
25586991 The results suggest that TRIB2 is a meaningful biomarker reflecting diagnosis and progression of melanoma, as well as predicting clinical response to chemotherapy.
25583260 Data suggest that TRB2 exhibits metal-independent autophosphorylation activity, low affinity ATP binding/hydrolysis, and a conserved catalytic lysine residue in the active site (rather than the asparagine in many metal-dependent kinases).
More...

AA Sequence

MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPL      1 - 70
EGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSF     71 - 140
VRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLS    141 - 210
DKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPK    211 - 280
AKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN           281 - 343
//

Text Mined References (53)

PMID Year Title
26517934 2015 Tribbles role in reproduction.
26517933 2015 Tribbles in normal and malignant haematopoiesis.
26517930 2015 Tribbles pseudokinases: novel targets for chemical biology and drug discovery?
26517929 2015 TRIB2 and the ubiquitin proteasome system in cancer.
26517928 2015 Tribbles breaking bad: TRIB2 suppresses FOXO and acts as an oncogenic protein in melanoma.
26517925 2015 Tribbles in inflammation.
26517922 2015 Tribbles and arthritis: what are the links?
26202930 2016 TRIB2 reinforces the oncogenic transcriptional program controlled by the TAL1 complex in T-cell acute lymphoblastic leukemia.
25586991 2015 TRIB2 as a biomarker for diagnosis and progression of melanoma.
25583260 2015 The Tribbles 2 (TRB2) pseudokinase binds to ATP and autophosphorylates in a metal-independent manner.
More...