Property Summary

NCBI Gene PubMed Count 57
PubMed Score 35.26
PubTator Score 37.49

Knowledge Summary

Patent (4,903)

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 2.574 1.7e-03
active ulcerative colitis 3.170 2.9e-03
aldosterone-producing adenoma -1.129 3.2e-02
Astrocytoma, Pilocytic 1.300 1.1e-04
Atopic dermatitis 1.300 2.3e-04
Chronic Lymphocytic Leukemia -2.392 2.0e-07
cystic fibrosis -1.713 1.5e-05
esophageal adenocarcinoma 1.600 1.9e-02
glioblastoma 1.500 6.9e-05
intraductal papillary-mucinous carcinoma... 1.400 4.1e-02
intraductal papillary-mucinous neoplasm ... 2.600 2.8e-03
lung cancer 1.500 6.5e-04
malignant mesothelioma -2.000 2.9e-06
medulloblastoma, large-cell 1.200 4.6e-04
oligodendroglioma 1.400 4.4e-02
osteosarcoma 2.669 1.2e-05
ovarian cancer 2.400 9.7e-06
pancreatic cancer 1.200 6.2e-04
pediatric high grade glioma 1.300 9.7e-04
primary pancreatic ductal adenocarcinoma 1.535 1.3e-03
primitive neuroectodermal tumor 1.500 2.5e-02
psoriasis 1.300 1.0e-03
sonic hedgehog group medulloblastoma 1.300 7.6e-03
tuberculosis 1.500 5.5e-05
Waldenstrons macroglobulinemia -1.736 7.7e-03

Synonym

Accession Q92519 B2R851 D6W510 TRB-2
Symbols C5FW
TRB2
GS3955

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (40)

AA Sequence

MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPL      1 - 70
EGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSF     71 - 140
VRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLS    141 - 210
DKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPK    211 - 280
AKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN           281 - 343
//

Text Mined References (60)

PMID Year Title