Property Summary

NCBI Gene PubMed Count 25
PubMed Score 31.24
PubTator Score 18.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 4.4e-06
medulloblastoma, large-cell 6241 1.0e-05
ovarian cancer 8520 3.2e-03
group 3 medulloblastoma 4104 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.300 4.5e-02
lung adenocarcinoma 1.415 4.4e-06
medulloblastoma, large-cell -1.900 1.0e-05
ovarian cancer 1.200 3.2e-03

Gene RIF (14)

AA Sequence

MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSHAHGHGHTHES      1 - 70
IWHGHTHDHDHGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGESGAPGIKQDLDAVTLWAYALG     71 - 140
ATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGLLGDAFLHLIPHALEPHSHHTLEQPGHGHSH    141 - 210
SGQGPILSVGLWVLSGIVAFLVVEKFVRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEE    211 - 280
KETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGIL    281 - 350
TTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVL    351 - 420
PFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVIMMVLIAHLE                         421 - 469
//

Text Mined References (29)

PMID Year Title