Property Summary

NCBI Gene PubMed Count 21
PubMed Score 5.22
PubTator Score 6.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.267 3.7e-05
adult high grade glioma -1.100 1.1e-02
astrocytoma 1.400 9.3e-03
group 4 medulloblastoma -1.300 6.2e-03
interstitial cystitis 1.700 4.1e-04
intraductal papillary-mucinous adenoma (... -1.300 6.4e-03
intraductal papillary-mucinous carcinoma... -2.300 5.4e-05
intraductal papillary-mucinous neoplasm ... -1.400 7.9e-03
lung adenocarcinoma -1.180 3.3e-06
malignant mesothelioma -1.200 7.7e-05
medulloblastoma, large-cell -1.800 1.6e-05
nephrosclerosis 1.116 2.4e-05
non primary Sjogren syndrome sicca 1.100 1.8e-02
ovarian cancer -1.300 3.8e-05
Pick disease 1.700 5.9e-06
psoriasis -1.300 4.3e-03
Rheumatoid arthritis 1.500 9.0e-03
spina bifida -1.058 3.8e-02
subependymal giant cell astrocytoma -1.749 9.8e-03
ulcerative colitis 2.300 1.7e-08

Gene RIF (6)

AA Sequence

MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLK      1 - 70
KIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPENEDWTCFEQSASLDIKSFFGF     71 - 140
ESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITTSSETSSSSSKKQAASMAVVIPE    141 - 210
AALKEGLSGDALSSPSAPEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHI    211 - 280
LRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMD    281 - 350
TKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV    351 - 420
VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGE    421 - 490
CMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILIQIVDASSVITWDFDVCKGDI    491 - 560
VFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQGSHVTRWPG    561 - 630
FYILQWKFHSMPACAASSLPRVDDVLASLQVSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAA    631 - 700
TTSSSQSHSSSMISR                                                           701 - 715
//

Text Mined References (28)

PMID Year Title