Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.99
PubTator Score 6.17

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
25701228 a markedly different role of SEC14L1 in TMPSSR2:ERG-negative and TMPSSR2:ERG-positive prostate cancers
23843640 These findings suggest that SEC14L1 functions as a novel negative regulator of RIG-I-mediated antiviral signaling by preventing RIG-I interaction with the downstream effector.
23083832 TCEB1 and SELC14L1 are good candidate markers for predicting prognosis and progression of prostate cancer.
22374094 Sec14 and Sec14 like proteins form central conduits to integrate multiple aspects of lipid metabolism with productive phosphoinositide signaling. (Review)
18187620 Knockdown of SEC14-like 1 (SEC14L1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLK      1 - 70
KIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPENEDWTCFEQSASLDIKSFFGF     71 - 140
ESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITTSSETSSSSSKKQAASMAVVIPE    141 - 210
AALKEGLSGDALSSPSAPEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHI    211 - 280
LRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMD    281 - 350
TKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV    351 - 420
VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGE    421 - 490
CMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILIQIVDASSVITWDFDVCKGDI    491 - 560
VFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQGSHVTRWPG    561 - 630
FYILQWKFHSMPACAASSLPRVDDVLASLQVSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAA    631 - 700
TTSSSQSHSSSMISR                                                           701 - 715
//

Text Mined References (27)

PMID Year Title
25701228 2015 Saccharomyces cerevisiae-like 1 overexpression is frequent in prostate cancer and has markedly different effects in Ets-related gene fusion-positive and fusion-negative cancers.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23843640 2013 Negative regulation of RIG-I-mediated innate antiviral signaling by SEC14L1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23083832 2012 A 12-gene expression signature is associated with aggressive histological in prostate cancer: SEC14L1 and TCEB1 genes are potential markers of progression.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22683750 2012 A meta-analysis of genome-wide association studies of the electrocardiographic early repolarization pattern.
22374094 2012 Sec14 like PITPs couple lipid metabolism with phosphoinositide synthesis to regulate Golgi functionality.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...