Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.99
PubTator Score 6.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ulcerative colitis 2087 1.73130053068886E-8
ovarian cancer 8492 1.49050041021668E-7
medulloblastoma, large-cell 6234 1.47347001417345E-6
lung adenocarcinoma 2714 3.34685626859502E-6
Pick disease 1893 5.87849017565823E-6
malignant mesothelioma 3163 1.23392567412321E-5
interstitial cystitis 2299 1.23874429633947E-5
nephrosclerosis 329 2.42275559001794E-5
adrenocortical carcinoma 1427 3.67012852214697E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.429663728339E-5
medulloblastoma 1524 0.00152545657557228
psoriasis 6685 0.00427867871314324
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00638473411721606
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00794203943312149
Rheumatoid Arthritis 1171 0.0090225771655211
astrocytoma 1493 0.00928735604907796
subependymal giant cell astrocytoma 2287 0.00977113729694489
adult high grade glioma 2148 0.0111715649610072
non primary Sjogren syndrome sicca 840 0.0178918251757154
spina bifida 1064 0.0375190743557201

Expression

Synonym

Accession Q92503 A8K4E8 B4DDI5 D5G3K1 Q99780
Symbols SEC14L
PRELID4A

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (5)

PMID Text
25701228 a markedly different role of SEC14L1 in TMPSSR2:ERG-negative and TMPSSR2:ERG-positive prostate cancers
23843640 These findings suggest that SEC14L1 functions as a novel negative regulator of RIG-I-mediated antiviral signaling by preventing RIG-I interaction with the downstream effector.
23083832 TCEB1 and SELC14L1 are good candidate markers for predicting prognosis and progression of prostate cancer.
22374094 Sec14 and Sec14 like proteins form central conduits to integrate multiple aspects of lipid metabolism with productive phosphoinositide signaling. (Review)
18187620 Knockdown of SEC14-like 1 (SEC14L1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLK      1 - 70
KIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPENEDWTCFEQSASLDIKSFFGF     71 - 140
ESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITTSSETSSSSSKKQAASMAVVIPE    141 - 210
AALKEGLSGDALSSPSAPEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHI    211 - 280
LRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMD    281 - 350
TKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV    351 - 420
VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGE    421 - 490
CMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILIQIVDASSVITWDFDVCKGDI    491 - 560
VFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQGSHVTRWPG    561 - 630
FYILQWKFHSMPACAASSLPRVDDVLASLQVSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAA    631 - 700
TTSSSQSHSSSMISR                                                           701 - 715
//

Text Mined References (27)

PMID Year Title
25701228 2015 Saccharomyces cerevisiae-like 1 overexpression is frequent in prostate cancer and has markedly different effects in Ets-related gene fusion-positive and fusion-negative cancers.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23843640 2013 Negative regulation of RIG-I-mediated innate antiviral signaling by SEC14L1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23083832 2012 A 12-gene expression signature is associated with aggressive histological in prostate cancer: SEC14L1 and TCEB1 genes are potential markers of progression.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22683750 2012 A meta-analysis of genome-wide association studies of the electrocardiographic early repolarization pattern.
22374094 2012 Sec14 like PITPs couple lipid metabolism with phosphoinositide synthesis to regulate Golgi functionality.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...