Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.42
PubTator Score 4.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
non-small cell lung cancer 2890 1.4e-24
lung adenocarcinoma 2716 6.7e-14
lung cancer 4740 4.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Craniofrontonasal syndrome 13 3.424 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.200 6.7e-14
lung cancer -1.300 4.2e-03
non-small cell lung cancer -1.381 1.4e-24

Gene RIF (4)

AA Sequence

MTLNNCASMKLEVHFQSKQNEDSEEEEQCTISSHWAFQQESKCWSPMGSSDLLAPPSPGLPATSSCESVL      1 - 70
TELSATSLPVITVSLPPEPADLPLPGRAPSSSDRPLLSPTQGQEGPQDKAKKRHRNRSFLKHLESLRRKE     71 - 140
KSGSQQAEPKHSPATSEKVSKASSFRSCRGFLSAGFYRAKNWAATSAGGSGANTRKAWEAWPVASFRHPQ    141 - 210
WTHRGDCLVHVPGDHKPGTFPRSLSIESLCPEDGHRLADWQPGRRWGCEGRRGSCGSTGSHASTYDNLPE    211 - 280
LYPAEPVMVGAEAEDEDDEESGGSYAHLDDILQHVWGLQQRVELWSRAMYPDLGPGDEEEEEATSSVEIA    281 - 350
TVEVKCQAEALSQMEVPAHGESPAWAQAEVQPAVLAPAQAPAEAEPVAQEEAEAPAPAPAPAPAQDSEQE    351 - 420
AHSGGEPTFASSLSVEEGHSISDTVASSSELDSSGNSMNEAEAAGPLAGLQASMPRERRDSGVGASLTRP    421 - 490
CRKLRWHSFQNSHRPSLNSESLEINRQFAGQINLLHKGSLLRLTAFMEKYTVPHKQGWVWSMPKFMRRNK    491 - 560
TPDYRGQHVFGVPPLIHVQRTGQPLPQSIQQAMRYLRSQCLDQVGIFRKSGVKSRIQNLRQMNETSPDNV    561 - 630
CYEGQSAYDVADLLKQYFRDLPEPIFTSKLTTTFLQIYQLLPKDQWLAAAQAATLLLPDENREVLQTLLY    631 - 700
FLSDIASAEENQMTAGNLAVCLAPSIFHLNVSKKDSPSPRIKSKRSLIGRPGPRDLSDNMAATQGLSHMI    701 - 770
SDCKKLFQVPQDMVLQLCSSYSAAELSPPGPALAELRQAQAAGVSLSLYMEENIQDLLRDAAERFKGWMS    771 - 840
VPGPQHTELACRKAPDGHPLRLWKASTEVAAPPAVVLHRVLRERALWDEDLLRAQVLEALMPGVELYHYV    841 - 910
TDSMAPHPCRDFVVLRMWRSDLPRGGCLLVSQSLDPEQPVPESGVRALMLTSQYLMEPCGLGRSRLTHIC    911 - 980
RADLRGRSPDWYNKVFGHLCAMEVAKIRDSFPTLQAAGPETKL                               981 - 1023
//

Text Mined References (16)

PMID Year Title