Property Summary

NCBI Gene PubMed Count 52
PubMed Score 44.80
PubTator Score 47.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Endometrial Hyperplasia 5 0.0 0.0
Substance-Related Disorders 115 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.4e-04
lung cancer 4740 1.0e-03
Multiple myeloma 1332 2.7e-03
sonic hedgehog group medulloblastoma 467 5.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 3.0
Disease Target Count Z-score Confidence
Neuroblastoma 80 4.142 2.1
Feingold syndrome 14 3.367 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.400 1.0e-03
Multiple myeloma 1.352 2.7e-03
ovarian cancer -1.700 1.4e-04
sonic hedgehog group medulloblastoma 1.200 5.7e-03

 MGI Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (40)

AA Sequence

MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKD      1 - 70
QQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCH     71 - 140
DQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGK    141 - 210
DLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQT    211 - 280
KFLPNAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRL    281 - 350
DDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSE    351 - 420
KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIK    421 - 490
ILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLER    491 - 560
FKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHV    561 - 630
CSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGS    631 - 700
YKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF                                  701 - 740
//

Text Mined References (62)

PMID Year Title