Property Summary

NCBI Gene PubMed Count 47
Grant Count 22
R01 Count 15
Funding $2,677,986.14
PubMed Score 42.51
PubTator Score 47.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.352 0.003
lung cancer 1.400 0.001
sonic hedgehog group medulloblastoma 1.200 0.006
ovarian cancer 2.400 0.000

Gene RIF (50)

PMID Text
26323305 crystal structure of the SPRY domain of human DDX1 (hDSPRY) is reported at 2.0 A resolution
25690890 Data indicate a tight binding of DEAD-box protein DDX1 to adenosine diphosphate (ADP), one of the strongest affinities observed for DEAD-box helicases.
25496916 HIV-1 wild type Tat co-immunoprecipitated with DDX1.
25496916 DEAD (Asp-Glu-Ala-Asp) box helicase 1 (DDX1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25496916 DEAD (Asp-Glu-Ala-Asp) box helicase 1 (DDX1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25496916 DEAD (Asp-Glu-Ala-Asp) box helicase 1 (DDX1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25496916 DEAD (Asp-Glu-Ala-Asp) box helicase 1 (DDX1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25496916 DEAD (Asp-Glu-Ala-Asp) box helicase 1 (DDX1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25496916 DEAD (Asp-Glu-Ala-Asp) box helicase 1 (DDX1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25496916 DEAD (Asp-Glu-Ala-Asp) box helicase 1 (DDX1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
More...

AA Sequence

MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKD      1 - 70
QQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCH     71 - 140
DQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGK    141 - 210
DLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQT    211 - 280
KFLPNAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRL    281 - 350
DDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSE    351 - 420
KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIK    421 - 490
ILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLER    491 - 560
FKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHV    561 - 630
CSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGS    631 - 700
YKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF                                  701 - 740
//

Text Mined References (55)

PMID Year Title
26323305 2015 Structure of the SPRY domain of the human RNA helicase DDX1, a putative interaction platform within a DEAD-box protein.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25690890 2015 Synergistic effects of ATP and RNA binding to human DEAD-box protein DDX1.
25496916 2014 A HIV-1 Tat mutant protein disrupts HIV-1 Rev function by targeting the DEAD-box RNA helicase DDX1.
24993907 2014 Common genes underlying asthma and COPD? Genome-wide analysis on the Dutch hypothesis.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24870230 2014 Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors.
24608264 2014 hCLE/C14orf166 associates with DDX1-HSPC117-FAM98B in a novel transcription-dependent shuttling RNA-transporting complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023901 2013 DEAD box protein DDX1 regulates cytoplasmic localization of KSRP.
More...