Property Summary

NCBI Gene PubMed Count 152
PubMed Score 403.00
PubTator Score 202.13

Knowledge Summary

Patent

No data available

Expression

 OMIM Phenotype (1)

Gene RIF (116)

AA Sequence

MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLG      1 - 70
ILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFADNQLFVSGP     71 - 140
NGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNS    141 - 210
GYAVNPARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEEN    211 - 280
VKLAHVKHKEQI                                                              281 - 292
//

Text Mined References (153)

PMID Year Title