Property Summary

NCBI Gene PubMed Count 135
Grant Count 72
R01 Count 50
Funding $7,862,724.44
PubMed Score 362.64
PubTator Score 202.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92482 A8K843 B2RE16 D3DRL3 O00108 Q6FGT2 Q6FGW6 AQP-3
Symbols GIL
AQP-3

Gene

PANTHER Protein Class (1)

Gene RIF (101)

PMID Text
26896765 these findings suggest that AQP3 is required for EGF-EGFR cell signaling in cancer cells and is a therapeutic target for cancer progression.
26830227 results demonstrate that AQP3 is required for CXCL12-induced breast cancer cell signaling and directional migration by a mechanism involving the CXCL12-induced generation of extracellular H2O2 and subsequent intracellular transport by AQP3
26810286 Expression of CXCL4 and aquaporin 3 and 10 mRNAs in middle ear effusion is associated with the pathophysiology of otitis media with effusion.
26786101 Based on a comparative mutagenic analysis of AQP1, AQP 3, and AQP 4, the results suggest that loop D interactions may provide a general structural framework for tetrameric assembly within the AQP family.
26765123 AQP3 knockdown retards the growth of NSCLC cells partially through inhibiting HIF-1alpha/VEGF and Raf/MEK/ERK signalling pathways.
26568619 AQP3 was expressed in trophoblast explants. Blocking it with CuSO4 prevented apoptosis.
26506416 AQP3 was found to be expressed in 67.71% of parts with GIM, and AQP3 immunoreactivity was identified more frequently in severe GIM areas (P < 0.001). In short, the incidence and severity of GIM correlated with the distance from GC, and AQP3 was differentially expressed in goblet cells, with most AQP3-positive goblet cells presenting in severe GIM.
26454884 treatment of human HepG2 cells with TCDD also increased the expression of AQP3 mRNA and protein
26313002 the human aquaglyceroporins, i.e., AQP3, AQP7, AQP9 and AQP10 can act as silicon transporters in both Xenopus laevis oocytes and HEK-293 cells.
26261083 The study demonstrated the abnormal expression pattern of AQP1, AQP2, AQP3, and AQP4 in the kidney tissues of patients with nephrotic syndrome, providing a basis for an improved understanding of the role of aquaporins in the pathogenesis of this disease.
More...

AA Sequence

MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLG      1 - 70
ILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFADNQLFVSGP     71 - 140
NGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNS    141 - 210
GYAVNPARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEEN    211 - 280
VKLAHVKHKEQI                                                              281 - 292
//

Text Mined References (136)

PMID Year Title
26896765 2016 Involvement of aquaporin-3 in epidermal growth factor receptor signaling via hydrogen peroxide transport in cancer cells.
26830227 2016 Aquaporin-3 Controls Breast Cancer Cell Migration by Regulating Hydrogen Peroxide Transport and Its Downstream Cell Signaling.
26810286 2016 Expression of CXCL4 and aquaporin 3 and 10 mRNAs in patients with otitis media with effusion.
26786101 2016 Structural Determinants of Oligomerization of the Aquaporin-4 Channel.
26765123 2016 Aquaporin-3 Inhibition Reduces the Growth of NSCLC Cells Induced by Hypoxia.
26568619 2016 Placental programmed cell death: insights into the role of aquaporins.
26506416 2015 Potential role of aquaporin 3 in gastric intestinal metaplasia.
26454884 2016 Regulation of Aquaporin 3 Expression by the AhR Pathway Is Critical to Cell Migration.
26313002 2015 Aquaporins Mediate Silicon Transport in Humans.
26261083 2015 Expression pattern of aquaporins in patients with primary nephrotic syndrome with edema.
More...