Property Summary

NCBI Gene PubMed Count 73
PubMed Score 52.87
PubTator Score 73.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -2.200 1.3e-02
cutaneous lupus erythematosus -2.400 6.1e-03
ductal carcinoma in situ 3.900 6.9e-04
fibroadenoma 2.200 4.1e-02
non primary Sjogren syndrome sicca 1.200 2.0e-02
posterior fossa group A ependymoma -1.200 4.2e-04
psoriasis -1.300 1.6e-05

 GO Component (2)

Protein-protein Interaction (3)

Gene RIF (54)

AA Sequence

MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYF      1 - 70
PPPYQPLPYHQSQDPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRD     71 - 140
YHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTS    141 - 210
LMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNG    211 - 280
GRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDL    281 - 350
HSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNY    351 - 420
LTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK                                  421 - 460
//

Text Mined References (73)

PMID Year Title