Property Summary

NCBI Gene PubMed Count 71
Grant Count 29
R01 Count 21
Funding $2,295,897.93
PubMed Score 50.11
PubTator Score 73.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.300 0.000
cutaneous lupus erythematosus -2.400 0.006
fibroadenoma 2.200 0.041
posterior fossa group A ependymoma -1.200 0.000
non primary Sjogren syndrome sicca 1.200 0.020
inflammatory breast cancer -3.000 0.019
ductal carcinoma in situ 4.300 0.001

 GO Component (1)

Gene RIF (52)

PMID Text
26598443 results suggest that TFAP2B is playing a vital role in retaining retinoic acid responsiveness and mediating noradrenergic neuronal differentiation in neuroblastoma.
26189251 The expression of TFAP-2beta mRNA in tissue of patients with endometrial carcinoma was higher than that of normal endometrium. The expression of TFAP-2beta mRNA in endometrial tissue of patients with metabolism syndrome was higher than that of lean ones.
24766673 TFAP2B overexpression contributes to tumor growth and a poor prognosis of human lung adenocarcinoma through modulation of ERK and VEGF/PEDF signaling.
24507797 A haploinsufficiency effect of TFAP2B could be involved in familial isolated patent ductus arteriosus.
24081236 TFAP2B rs987237 and dietary protein/carbohydrate interacted to modify weight maintenance.
23881096 The AP-2beta polymorphism significantly influenced cognitive performance, whereas the MAOA and COMT polymorphisms did not.
23824473 The presence of the nine-repeat variant of the TFAP-2beta intron 1 VNTR appears to protect girls with ADHD symptoms from the co-expression of symptoms of depression.
22959235 genomic GATA4 and TFAP2B missense mutations may be associated with nonfamilial congenital heart disease with diverse clinical phenotypes in patients with congenital heart disease from southern China
22952648 Under energy restriction, TFAP2B may modify the effect of dietary fat intake on weight loss and waist reduction
22199100 The findings suggest the lack of involvement of known mutations of TFAP2B with syndromic or nonsyndromic CHDs in Mysore patients
More...

AA Sequence

MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHTPSSDFQPPYF      1 - 70
PPPYQPLPYHQSQDPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRD     71 - 140
YHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLLDQSVIKKVPVPPKSVTS    141 - 210
LMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGGVLRRAKSKNG    211 - 280
GRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICETEFPAKAVSEYLNRQHTDPSDL    281 - 350
HSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEPGIQSCLTHFSLITHGFGAPAICAALTALQNY    351 - 420
LTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK                                  421 - 460
//

Text Mined References (70)

PMID Year Title
26598443 2016 Transcription factor activating protein 2 beta (TFAP2B) mediates noradrenergic neuronal differentiation in neuroblastoma.
26189251 2015 Correlation between transcription factor activator protein-2? (TFAP-2?) and endometrial carcinoma.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24766673 2014 TFAP2B overexpression contributes to tumor growth and a poor prognosis of human lung adenocarcinoma through modulation of ERK and VEGF/PEDF signaling.
24507797 2014 Characterization of transcription factor AP-2 ? mutations involved in familial isolated patent ductus arteriosus suggests haploinsufficiency.
24081236 2013 TFAP2B -dietary protein and glycemic index interactions and weight maintenance after weight loss in the DiOGenes trial.
23881096 2013 Neuropsychological correlates of transcription factor AP-2Beta, and its interaction with COMT and MAOA in healthy females.
23824473 2014 Transcription Factor Activating Protein-2? (TFAP-2?) genotype and symptoms of attention deficit hyperactivity disorder in relation to symptoms of depression in two independent samples.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22959235 Analyses of GATA4, NKX2.5, and TFAP2B genes in subjects from southern China with sporadic congenital heart disease.
More...