Property Summary

NCBI Gene PubMed Count 100
PubMed Score 123.85
PubTator Score 109.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP E 1 0.0 0.0
Disease Target Count Z-score Confidence
Cockayne syndrome 60 4.575 2.3
Cancer 2499 3.401 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 5.3e-07
group 3 medulloblastoma 1.500 2.4e-04
inflammatory breast cancer -1.100 1.3e-03
malignant mesothelioma -2.000 1.9e-06
osteosarcoma -2.568 4.9e-06
ovarian cancer -1.200 2.4e-06
subependymal giant cell astrocytoma 1.554 2.6e-03

Protein-protein Interaction (12)

Gene RIF (78)

AA Sequence

MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIV      1 - 70
RTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWN     71 - 140
FGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVS    141 - 210
ASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKAS    211 - 280
FLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNL    281 - 350
IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ    351 - 420
EEARTRK                                                                   421 - 427
//

Text Mined References (116)

PMID Year Title