Property Summary

NCBI Gene PubMed Count 91
Grant Count 94
R01 Count 70
Funding $7,722,835.34
PubMed Score 116.63
PubTator Score 109.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
osteosarcoma -2.568 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
group 3 medulloblastoma 1.500 0.000
subependymal giant cell astrocytoma 1.554 0.003
non-inflammatory breast cancer -1.200 0.002
ovarian cancer -1.200 0.000

Synonym

Accession Q92466 B2R875 Q76E54 Q76E55 Q76E56 Q76E57
Symbols XPE
DDBB
UV-DDB2

Gene

PDB

3EI4   3I7L   4E54   4E5Z  

 GWAS Trait (1)

Gene RIF (72)

PMID Text
26410533 PKM2 interacts with DDB2 and reduces cell survival upon UV irradiation.
26263968 the release of NER components such as DNA damage binding protein 2 (DDB2) and Xeroderma Pigmentosum complementation group C protein (XPC) following oxidative stress might putatively involve their apoptotic role rather than DNA repair function.
26205499 DDB2 is involved in ubiquitination and degradation of PAQR3 in gastric cancer cells.
26187069 data demonstrated that the DDB2 IRES activity was promoted during stress conditions. These results reveal a novel mechanism contributing to DDB2 expression
26130719 DDB2 can bind to the promoter region of NEDD4L and recruit enhancer of zeste homolog 2 histone methyltransferase to repress NEDD4L transcription by enhancing histone H3 lysine 27 trimethylation at the NEDD4L promoter.
25628365 DDB2 is protected by XPC from ubiquitination and degradation in a stochastic manner; thus XPC allows DDB2 to initiate multiple rounds of repair events, thereby contributing to the persistence of cellular DNA repair capacity
24770583 Chromatin retention of DNA damage sensors DDB2 and XPC through loss of p97 segregase causes genotoxicity.
24760829 UV-DDB examines sites on DNA in discrete steps before forming long-lived, nonmotile UV-DDB dimers (DDB1-DDB2)2 at sites of damage.
24753253 study provides new knowledge about the posttranslational regulation of DDB2 and expands the biological functions of protein alpha-N-methylation to DNA repair
24574518 DDB2 protein expression is low in ovarian tumor cells.
More...

AA Sequence

MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIV      1 - 70
RTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWN     71 - 140
FGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVS    141 - 210
ASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKAS    211 - 280
FLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNL    281 - 350
IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ    351 - 420
EEARTRK                                                                   421 - 427
//

Text Mined References (109)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26410533 2015 Pyruvate kinase M2 interacts with DNA damage-binding protein 2 and reduces cell survival upon UV irradiation.
26263968 2015 Combination of A? Secretion and Oxidative Stress in an Alzheimer-Like Cell Line Leads to the Over-Expression of the Nucleotide Excision Repair Proteins DDB2 and XPC.
26205499 2015 DDB2 is involved in ubiquitination and degradation of PAQR3 and regulates tumorigenesis of gastric cancer cells.
26187069 2015 The 5'-UTR of DDB2 harbors an IRES element and upregulates translation during stress conditions.
26130719 2015 DDB2 modulates TGF-? signal transduction in human ovarian cancer cells by downregulating NEDD4L.
25628365 2015 Functional regulation of the DNA damage-recognition factor DDB2 by ubiquitination and interaction with xeroderma pigmentosum group C protein.
24770583 2014 Chromatin retention of DNA damage sensors DDB2 and XPC through loss of p97 segregase causes genotoxicity.
24760829 2014 Single-molecule analysis reveals human UV-damaged DNA-binding protein (UV-DDB) dimerizes on DNA via multiple kinetic intermediates.
24753253 2014 ?-N-methylation of damaged DNA-binding protein 2 (DDB2) and its function in nucleotide excision repair.
More...