Property Summary

NCBI Gene PubMed Count 32
Grant Count 8
R01 Count 1
Funding $436,904.85
PubMed Score 134.54
PubTator Score 105.09

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
26884342 Sequence Requirements for Neuropilin-2 Recognition by ST8SiaIV and Polysialylation of Its O-Glycans.
25855199 ST8SIA4 gene is involved in the development of multidrug resistance via PI3K/Akt pathway in chronic myeloid leukemia.
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that ST8SIA4 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with ST8SIA4
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that ST8SIA4 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with ST8SIA4
24531716 this study indicated that sialylation involved in the development of MDR of AML cells probably through ST3GAL5 or ST8SIA4 regulating the activity of PI3K/Akt signaling and the expression of P-gp and MRP1.
23801331 ST8SiaIV synthesized polySia selectively on a NRP2 glycoform that was characterized by the presence of sialylated core 1 and core 2 O-glycans.
22184126 The ST8SiaIV/PST polybasic region plays a critical role in substrate recognition.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEG      1 - 70
WKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFK     71 - 140
TCAVVGNSGILLDSECGKEIDSHNFVIRCNLAPVVEFAADVGTKSDFITMNPSVVQRAFGGFRNESDREK    141 - 210
FVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNALILKNKLKVRTAYPSLRLIHAVRGYWLTNKVPIKRPST    211 - 280
GLLMYTLATRFCDEIHLYGFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGALK    281 - 350
LTTGKCVKQ                                                                 351 - 359
//

Text Mined References (35)

PMID Year Title
26884342 2016 Sequence Requirements for Neuropilin-2 Recognition by ST8SiaIV and Polysialylation of Its O-Glycans.
25855199 2015 ?-2,8-Sialyltransferase Is Involved in the Development of Multidrug Resistance via PI3K/Akt Pathway in Human Chronic Myeloid Leukemia.
24785509 2014 A genome wide association study (GWAS) providing evidence of an association between common genetic variants and late radiotherapy toxicity.
24531716 2015 Modification of sialylation is associated with multidrug resistance in human acute myeloid leukemia.
23801331 2013 Polysialic acid on neuropilin-2 is exclusively synthesized by the polysialyltransferase ST8SiaIV and attached to mucin-type o-glycans located between the b2 and c domain.
22184126 2012 Sequences prior to conserved catalytic motifs of polysialyltransferase ST8Sia IV are required for substrate recognition.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19725832 2010 N-CAM dysfunction and unexpected accumulation of PSA-NCAM in brain of adult-onset autosomal-dominant leukodystrophy.
More...