Property Summary

NCBI Gene PubMed Count 35
PubMed Score 137.83
PubTator Score 105.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytic glioma -1.600 3.6e-02
Astrocytoma, Pilocytic 1.500 3.7e-04
atypical teratoid / rhabdoid tumor 1.200 2.6e-02
gastric cancer 1.300 6.5e-03
glioblastoma 1.300 5.2e-04
hepatocellular carcinoma 1.200 1.4e-03
interstitial cystitis 1.400 4.2e-03
intraductal papillary-mucinous carcinoma... -1.200 2.3e-02
invasive ductal carcinoma 1.100 1.6e-03
lung cancer -1.200 3.2e-02
oligodendroglioma -1.900 2.1e-02
osteosarcoma -1.245 2.1e-02
ovarian cancer 1.400 2.5e-03
pancreatic cancer 1.600 3.4e-03
pancreatic carcinoma 1.600 3.4e-03
pediatric high grade glioma 1.400 2.7e-03
periodontitis 1.100 5.0e-17
posterior fossa group B ependymoma -1.500 4.0e-03
primary Sjogren syndrome 1.500 6.2e-03
sarcoidosis 1.400 2.0e-02
sonic hedgehog group medulloblastoma 1.200 2.7e-03
subependymal giant cell astrocytoma 1.907 2.2e-02
tuberculosis -1.200 1.5e-02
ulcerative colitis 2.100 1.3e-04
uncontrolled asthma -1.500 3.2e-02

Gene RIF (22)

AA Sequence

MRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEG      1 - 70
WKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFK     71 - 140
TCAVVGNSGILLDSECGKEIDSHNFVIRCNLAPVVEFAADVGTKSDFITMNPSVVQRAFGGFRNESDREK    141 - 210
FVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNALILKNKLKVRTAYPSLRLIHAVRGYWLTNKVPIKRPST    211 - 280
GLLMYTLATRFCDEIHLYGFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGALK    281 - 350
LTTGKCVKQ                                                                 351 - 359
//

Text Mined References (38)

PMID Year Title