Property Summary

NCBI Gene PubMed Count 32
Grant Count 248
R01 Count 158
Funding $29,134,345.9
PubMed Score 1524.74
PubTator Score 211.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Synonym

Accession Q92186 Q4VAZ0 Q92470 Q92746
Symbols STX
SIAT8B
SIAT8-B
HsT19690
ST8SiaII
ST8SIA-II

Gene

 GWAS Trait (1)

Gene RIF (18)

PMID Text
27105834 the relationships between psychiatric disorders and polySia and/or ST8SIA2
26418860 Data indicate a possible role of STX polysialyltransferase (ST8SIA2) in the common susceptibility of schizophrenia and bipolar I disorder (BD-I).
24651862 the role of ST8SIA2 sequence variation affecting polysialic acid-NCAM formation in 48 Caucasian cases with bipolar disorder
24070986 Our study showed interesting sex-specific associations between ST8SIAII and schizophrenia.
23671285 translational modification of the neural cell adhesion molecule NCAM and the polysialyltransferase ST8SiaII in mammalian semen involves polysialic acid
23643386 Expression of ST8SIA2 in omental fat at baseline was significantly associated with weight loss after Roux-en-Y gastric bypass.
22693595 that variation the ST8SIA2 gene is associated with increased risk to mental illness
22281821 NCAM and polySia are expressed and developmentally regulated in chick corneas. Both membrane-associated and soluble NCAM isoforms are expressed in chick corneas.
21555518 ST8SIA2 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21464126 STX(G421A) shows a dramatic decrease in polySia synthetic activity on NCAM, whereas STX(C621G) does not; polySia shows a dopamine (DA) binding activity
More...

AA Sequence

MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDR      1 - 70
SNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLY     71 - 140
ELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVI    141 - 210
QRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVR    211 - 280
GYWLTNKVHIKRPTTGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPL    281 - 350
EFKALKSLHEQGALKLTVGQCDGAT                                                 351 - 375
//

Text Mined References (32)

PMID Year Title
27105834 2016 Relationship between ST8SIA2, polysialic acid and its binding molecules, and psychiatric disorders.
26418860 2015 Association between ST8SIA2 and the Risk of Schizophrenia and Bipolar I Disorder across Diagnostic Boundaries.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24651862 2014 Characterisation of genetic variation in ST8SIA2 and its interaction region in NCAM1 in patients with bipolar disorder.
24070986 2013 Sex-specific association of the ST8SIAII gene with schizophrenia in a Spanish population.
23671285 2013 Polysialic acid is present in mammalian semen as a post-translational modification of the neural cell adhesion molecule NCAM and the polysialyltransferase ST8SiaII.
23643386 2013 Weight loss after gastric bypass is associated with a variant at 15q26.1.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
More...