Property Summary

NCBI Gene PubMed Count 34
PubMed Score 1661.45
PubTator Score 211.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 1.5e-04
Breast cancer -1.300 6.6e-23
group 3 medulloblastoma 1.300 3.2e-03
medulloblastoma, large-cell 1.200 1.2e-02
primitive neuroectodermal tumor 1.100 2.0e-02

Gene RIF (20)

AA Sequence

MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDR      1 - 70
SNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLY     71 - 140
ELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVI    141 - 210
QRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVR    211 - 280
GYWLTNKVHIKRPTTGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPL    281 - 350
EFKALKSLHEQGALKLTVGQCDGAT                                                 351 - 375
//

Text Mined References (34)

PMID Year Title