Property Summary

NCBI Gene PubMed Count 37
Grant Count 11
R01 Count 11
Funding $1,794,995
PubMed Score 33.66
PubTator Score 36.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (27)

PMID Text
25163442 Though results are limited by the small sample size, variants in BDNF and ST8SIA may slow down the early response to antidepressants in subjects non-exposed to stressors at the illness onset, with a remarkable gene-environment interaction
25109336 Results show that GD3S regulates stem cell function via c-Met and the expression of GD3S is regulated by FOXC2, a transcription factor functioning downstream of several epithelial-mesenchymal transition signaling pathways.
24842107 our study provides support for the GD3-induced cell cycle arrest, disruption of integrin-b1-mediated anchorage, inhibition of angiogenesis and thereby induced apoptosis in pancreatic cancer cells.
24548412 TNF-alpha and IL-6 secreted from keratinocytes enhanced ST8SIA1 expression in melanocytes.
22885356 This indicates that ST8Sia I is able to act as an oligosialyltransferase in a cellular context.
20889649 Results show that G(D3) synthase expression is sufficient to enhance the tumorigenicity of MDA-MB-231 breast cancer cells through a ganglioside-dependent activation of the c-Met receptor.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19956670 GD3 has a role in hypoxia susceptibility by disabling the c-Src/NF-kappaB survival pathway resulting in lower Mn-SOD expression
19428123 Variants in ST8SIA1 do not play a major role in susceptibility to multiple sclerosis in Canadian families.
19428123 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRR      1 - 70
NQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAV     71 - 140
VGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNM    141 - 210
KIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLV    211 - 280
SAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDT    281 - 350
SLQPTS                                                                    351 - 356
//

Text Mined References (40)

PMID Year Title
25163442 2014 Genes involved in neuroplasticity and stressful life events act on the short-term response to antidepressant treatment: a complex interplay between genetics and environment.
25109336 2015 GD3 synthase regulates epithelial-mesenchymal transition and metastasis in breast cancer.
24842107 2014 Disialoganglioside GD3-synthase over expression inhibits survival and angiogenesis of pancreatic cancer cells through cell cycle arrest at S-phase and disruption of integrin-?1-mediated anchorage.
24548412 2014 UVB-irradiated keratinocytes induce melanoma-associated ganglioside GD3 synthase gene in melanocytes via secretion of tumor necrosis factor ? and interleukin 6.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
22885356 2012 Accumulation of unusual gangliosides G(Q3) and G(P3) in breast cancer cells expressing the G(D3) synthase.
20889649 2010 GD? synthase expression enhances proliferation and tumor growth of MDA-MB-231 breast cancer cells through c-Met activation.
20708005 2010 Genome-wide association study identifies variants associated with histologic features of nonalcoholic Fatty liver disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19956670 2009 GD3 synthase overexpression sensitizes hepatocarcinoma cells to hypoxia and reduces tumor growth by suppressing the cSrc/NF-kappaB survival pathway.
More...