Property Summary

NCBI Gene PubMed Count 41
PubMed Score 35.43
PubTator Score 36.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -1.239 1.1e-03
aldosterone-producing adenoma -1.586 6.9e-03
atypical teratoid/rhabdoid tumor -1.300 4.6e-02
Breast cancer -3.300 5.9e-25
colon cancer -2.000 3.0e-06
group 3 medulloblastoma -1.300 3.4e-02
lung cancer -1.700 2.4e-03
medulloblastoma, large-cell -1.200 2.3e-03
non primary Sjogren syndrome sicca -1.100 1.9e-02
pediatric high grade glioma 1.500 2.3e-03
pituitary cancer 1.400 1.3e-02
posterior fossa group A ependymoma 1.500 1.0e-03
primitive neuroectodermal tumor 1.200 5.0e-02

Protein-protein Interaction (8)

Gene RIF (31)

AA Sequence

MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRR      1 - 70
NQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAV     71 - 140
VGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNM    141 - 210
KIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLV    211 - 280
SAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDT    281 - 350
SLQPTS                                                                    351 - 356
//

Text Mined References (44)

PMID Year Title