Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 8.7e-05
gastric carcinoma 807 1.8e-02
Disease Target Count Z-score Confidence
Nicotine dependence 54 4.423 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
gastric carcinoma -1.100 1.8e-02
osteosarcoma 2.108 8.7e-05

Synonym

Accession Q8WZB0
Symbols NAG11
NAG12
C9orf130

 Compartment GO Term (0)

AA Sequence

MAANATSGRPPSIALRQPEATGWRRGIPAKVATKGTQAEREGDVRSGGRARGRCVRLAKRCSPSSLGLRR      1 - 70
RRRRTGGRQGDPQIFLGSDFRLLTPANSNPVLENPARTGSRIVIGISRERNLPFCGRSNLPDVSSL         71 - 136
//

Text Mined References (3)

PMID Year Title