Knowledge Summary

Patent

No data available

Synonym

Accession Q8WZA8 GCRG-224
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MIPGNPSPGADLAVSKHFFSLSWFCGLLLLESKQK                                         1 - 35
//

Text Mined References (1)

PMID Year Title
12508346 2003 A novel gene, GCRG224, is differentially expressed in human gastric mucosa.