Knowledge Summary


No data available


Accession Q8WZA8 GCRG-224


 Compartment GO Term (0)

AA Sequence

MIPGNPSPGADLAVSKHFFSLSWFCGLLLLESKQK                                         1 - 35

Text Mined References (1)

PMID Year Title