Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.2e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.386 1.2e-05

Gene RIF (1)

AA Sequence

MMKKNQTMISEFLLLGLPIQPEQQNLFYALFLAVYLTTLLGNLLVIVLIRLDSHLHMPMYLCLSNLSFSD      1 - 70
LCFSSVTMPKLLQNMQSQNPSIPFADCLAQMYFHLFYGVLESFLLVVMAYHCYVAICFPLHYTTIMSPKC     71 - 140
CLGLLTLSWLLTTAHATLHTLLMARLSFCAENVIPHFFCDTSTLLKLACSNTQVNGWVMFFMGGLILVIP    141 - 210
FLLLIMSCARIVSTILRVPSTGGIQKAFSTCGPHLSVVSLFYGTIIGLYLCPLTNHNTVKDTVMAVMYTG    211 - 280
VTHMLNPFIYSLRNRDMRGNPGQSLQHKENFFVFKIVIVGILPLLNLVGVVKLIMKYHSKSVA           281 - 343
//

Text Mined References (10)

PMID Year Title