Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

Gene RIF (1)

PMID Text
12379593 OR17-201 exhibits specific saturable binding to the pig odorant-binding protein, in contrast to OR17-209

AA Sequence

MMKKNQTMISEFLLLGLPIQPEQQNLFYALFLAVYLTTLLGNLLVIVLIRLDSHLHMPMYLCLSNLSFSD      1 - 70
LCFSSVTMPKLLQNMQSQNPSIPFADCLAQMYFHLFYGVLESFLLVVMAYHCYVAICFPLHYTTIMSPKC     71 - 140
CLGLLTLSWLLTTAHATLHTLLMARLSFCAENVIPHFFCDTSTLLKLACSNTQVNGWVMFFMGGLILVIP    141 - 210
FLLLIMSCARIVSTILRVPSTGGIQKAFSTCGPHLSVVSLFYGTIIGLYLCPLTNHNTVKDTVMAVMYTG    211 - 280
VTHMLNPFIYSLRNRDMRGNPGQSLQHKENFFVFKIVIVGILPLLNLVGVVKLIMKYHSKSVA           281 - 343
//

Text Mined References (7)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14983052 2004 The human olfactory receptor gene family.
12730696 2003 Different noses for different people.
12379593 2002 Porcine odorant-binding protein selectively binds to a human olfactory receptor.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.
8004088 1994 Olfactory receptor gene cluster on human chromosome 17: possible duplication of an ancestral receptor repertoire.