Property Summary

NCBI Gene PubMed Count 41
Grant Count 33
R01 Count 22
Funding $2,277,164.86
PubMed Score 267.66
PubTator Score 54.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
nephrosclerosis 1.020 0.004
urothelial carcinoma -1.400 0.004
malignant mesothelioma -3.300 0.000
ependymoma -4.100 0.000
psoriasis -1.200 0.001
astrocytoma -4.300 0.000
glioblastoma -4.900 0.000
oligodendroglioma -2.100 0.000
medulloblastoma -4.800 0.000
atypical teratoid / rhabdoid tumor -4.500 0.000
medulloblastoma, large-cell -4.500 0.000
primitive neuroectodermal tumor -2.300 0.008
adrenocortical carcinoma -2.647 0.001
non-small cell lung carcinoma -1.600 0.000
lung cancer 1.600 0.000
lung adenocarcinoma -1.600 0.000
pediatric high grade glioma -2.500 0.003
pilocytic astrocytoma -1.200 0.044
lung carcinoma 1.400 0.000
pituitary cancer 1.800 0.000

 GWAS Trait (1)

Gene RIF (25)

PMID Text
26390815 Data show that Epac2 is activated by cAMP and changes its structure. It is involved in cAMP-mediated signal transduction through activation of the Ras-like small GTPase and is expressed mainly in brain, neuroendocrine and endocrine tissues. [review]
25683912 Identified a conserved nuclear pore localisation signal (NPLS; amino acids 764-838 of EPAC1) in the catalytic domains of the cAMP-sensors, EPAC1 and EPAC2A. EPAC1 and EPAC2, display distinct subcellular distributions.
25378661 CALR regulated by EPAC2 in endometrial glandular epithelial cells is critical for the expression of LIF and PTGS2-mediated production of PGE2 through cAMP signaling.
25187374 Follow-up replication analyses in up to an additional 21,345 participants identified three new fasting plasma glucose loci reaching genome-wide significance in or near PDK1-RAPGEF4, KANK1, and IGF1R.
25122553 EPAC1 and EPAC2 are critical signaling intermediates in osteoclast differentiation that permit RANKL-stimulated NFkB nuclear translocation and actin rearrangements
24586238 Prostaglandin E2-mediated HIV-1 inhibition requires the EPAC/RAP/RhoA signaling pathway by downregulation of HIV-1 CA production
24169561 EPAC2-mediated CRT expression is essential for the functional and morphological differentiation of endometrial stromal cells into decidual cells
23804752 data show the expression of EPAC is blunted in HPRT-deficient neuron-like cell lines and fibroblast cells from Lesch-Nyhan syndrome (LNS) patients; propose that the alterations in EPAC/RAP1 signaling and cell migration in HPRT deficiency are crucial for neuro-developmental events that may contribute to neurological dysfunctions in LNS
22363678 Cigarette smoke extract decreased Epac1 expression, but did not affect Epac2 and PKA expression.
21454623 Mechanism of intracellular cAMP sensor Epac2 activation: cAMP-induced conformational changes identified by amide hydrogen/deuterium exchange mass spectrometry
More...

AA Sequence

MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITL      1 - 70
FRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDNTPRHATIVTRESSELLRIEQ     71 - 140
KDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENTPLIEPHVPLRPANTITKVPSEKILRAGKIL    141 - 210
RNAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMMQQTPCVHSRTQAVGMWQVLLEDGVLNHVDQEHHF    211 - 280
QDKYLFYRFLDDEHEDAPLPTEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEE    281 - 350
LLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDD    351 - 420
FGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQG    421 - 490
NSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLCPALVAHYHAQPSQ    491 - 560
GTEQEKMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVSMAFLEEFYVSVSDDARMIAALKEQLPELEKIV    561 - 630
KQISEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVYCMDHTYTTIRVPVATSVKEVISAVA    631 - 700
DKLGSGEGLIIVKMSSGGEKVVLKPNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTVGTVGTFEL    701 - 770
MSSKDLAYQMTIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKR    771 - 840
VQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYR    841 - 910
LTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPDAAQANKNH    911 - 980
QDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP                                           981 - 1011
//

Text Mined References (43)

PMID Year Title
26390815 2016 Structure and functional roles of Epac2 (Rapgef4).
25683912 2015 The cAMP sensors, EPAC1 and EPAC2, display distinct subcellular distributions despite sharing a common nuclear pore localisation signal.
25416956 2014 A proteome-scale map of the human interactome network.
25378661 2015 EPAC2-mediated calreticulin regulates LIF and COX2 expression in human endometrial glandular cells.
25187374 2015 Genome-wide association meta-analysis identifies novel variants associated with fasting plasma glucose in East Asians.
25122553 2014 Activation of EPAC1/2 is essential for osteoclast formation by modulating NF?B nuclear translocation and actin cytoskeleton rearrangements.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24169561 2014 The role of exchange protein directly activated by cyclic AMP 2-mediated calreticulin expression in the decidualization of human endometrial stromal cells.
23804752 2013 Deficiency of the purine metabolic gene HPRT dysregulates microRNA-17 family cluster and guanine-based cellular functions: a role for EPAC in Lesch-Nyhan syndrome.
22363678 2012 Anti-inflammatory role of the cAMP effectors Epac and PKA: implications in chronic obstructive pulmonary disease.
More...