Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.44
PubTator Score 2.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.34908778507516E-5
osteosarcoma 7933 0.00117941777509931
diabetes mellitus 1663 0.00156975021666573
group 3 medulloblastoma 2254 0.00269306421169621
Disease Target Count Z-score Confidence
Schnyder Corneal Dystrophy 24 4.252 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.089 0.001
diabetes mellitus -1.200 0.002
group 3 medulloblastoma 1.500 0.003
ovarian cancer 1.700 0.000

Synonym

Accession Q8WZA0 B2R6F0 B4E2N0 Q96IU1
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (2)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTL      1 - 70
VDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRK     71 - 140
LGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK                        141 - 190
//

Text Mined References (10)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11712074 2001 Molecular cloning and characterization of LZIC, a novel gene encoding ICAT homologous protein with leucine zipper domain.