Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.44
PubTator Score 0.45

Knowledge Summary

Patent (285)

TINX Plot

AA Sequence

MGTGNDTTVVEFTLLGLSEDTTVCAILFLVFLGIYVVTLMGNISIIVLIRRSHHLHTPMYIFLCHLAFVD      1 - 70
IGYSSSVTPVMLMSFLRKETSLPVAGCVAQLCSVVTFGTAECFLLAAMAYDRYVAICSPLLYSTCMSPGV     71 - 140
CIILVGMSYLGGCVNAWTFIGCLLRLSFCGPNKVNHFFCDYSPLLKLACSHDFTFEIIPAISSGSIIVAT    141 - 210
VCVIAISYIYILITILKMHSTKGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTV    211 - 280
VIPMLNPLIYSLRNKEIKGALKRELRIKIFS                                           281 - 311
//

Text Mined References (3)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
11705801 2001 New GPCRs from a human lingual cDNA library.