Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.44
PubTator Score 0.45

Knowledge Summary

Patent (285)

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung carcinoma 317 3.5e-20
lung carcinoma 2843 1.2e-19
lung adenocarcinoma 2716 9.8e-09
Breast cancer 3578 2.8e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

AA Sequence

MGTGNDTTVVEFTLLGLSEDTTVCAILFLVFLGIYVVTLMGNISIIVLIRRSHHLHTPMYIFLCHLAFVD      1 - 70
IGYSSSVTPVMLMSFLRKETSLPVAGCVAQLCSVVTFGTAECFLLAAMAYDRYVAICSPLLYSTCMSPGV     71 - 140
CIILVGMSYLGGCVNAWTFIGCLLRLSFCGPNKVNHFFCDYSPLLKLACSHDFTFEIIPAISSGSIIVAT    141 - 210
VCVIAISYIYILITILKMHSTKGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTV    211 - 280
VIPMLNPLIYSLRNKEIKGALKRELRIKIFS                                           281 - 311
//

Text Mined References (3)

PMID Year Title