Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.44
PubTator Score 0.45

Knowledge Summary

Patent (285)


  Disease Sources (1)

Disease Target Count P-value
non-small cell lung carcinoma 413 3.49369796763273E-20
lung carcinoma 2844 1.24214597115403E-19
lung adenocarcinoma 2714 1.04431899939449E-9
Breast cancer 3099 2.7914471477149E-7

AA Sequence

VIPMLNPLIYSLRNKEIKGALKRELRIKIFS                                           281 - 311

Text Mined References (3)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
11705801 2001 New GPCRs from a human lingual cDNA library.