Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.49
PubTator Score 0.36

Knowledge Summary

Patent (239)

TINX Plot

AA Sequence

MNSLKDGNHTALTGFILLGLTDDPILRVILFMIILSGNLSIIILIRISSQLHHPMYFFLSHLAFADMAYS      1 - 70
SSVTPNMLVNFLVERNTVSYLGCAIQLGSAAFFATVECVLLAAMAYDRFVAICSPLLYSTKMSTQVSVQL     71 - 140
LLVVYIAGFLIAVSYTTSFYFLLFCGPNQVNHFFCDFAPLLELSCSDISVSTVVLSFSSGSIIVVTVCVI    141 - 210
AVCYIYILITILKMRSTEGHHKAFSTCTSHLTVVTLFYGTITFIYVMPNFSYSTDQNKVVSVLYTVVIPM    211 - 280
LNPLIYSLRNKEIKGALKRELVRKILSHDACYFSRTSNNDIT                                281 - 322
//

Text Mined References (4)

PMID Year Title