Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.49
PubTator Score 0.36

Knowledge Summary

Patent (239)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung carcinoma 413 1.13869957369542E-24
lung carcinoma 2844 2.65515361701278E-21
lung adenocarcinoma 2714 4.51600522909743E-13
ovarian cancer 8492 9.6222368459651E-11
adult high grade glioma 2148 4.34291455689127E-5
medulloblastoma, large-cell 6234 5.01287096518142E-5
glioblastoma 5572 0.0040094407209429
non primary Sjogren syndrome sicca 840 0.0155184000777018

AA Sequence

MNSLKDGNHTALTGFILLGLTDDPILRVILFMIILSGNLSIIILIRISSQLHHPMYFFLSHLAFADMAYS      1 - 70
SSVTPNMLVNFLVERNTVSYLGCAIQLGSAAFFATVECVLLAAMAYDRFVAICSPLLYSTKMSTQVSVQL     71 - 140
LLVVYIAGFLIAVSYTTSFYFLLFCGPNQVNHFFCDFAPLLELSCSDISVSTVVLSFSSGSIIVVTVCVI    141 - 210
AVCYIYILITILKMRSTEGHHKAFSTCTSHLTVVTLFYGTITFIYVMPNFSYSTDQNKVVSVLYTVVIPM    211 - 280
LNPLIYSLRNKEIKGALKRELVRKILSHDACYFSRTSNNDIT                                281 - 322
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11705801 2001 New GPCRs from a human lingual cDNA library.