Property Summary

NCBI Gene PubMed Count 41
Grant Count 49
R01 Count 25
Funding $4,063,560.36
PubMed Score 93.81
PubTator Score 46.38

Knowledge Summary

Patent

No data available

Expression

Gene RIF (35)

PMID Text
27041242 there was a increase in Robo4 expression under hyperglycemic conditions, while there was a decrease under hypoxic and combined hypoxic and hyperglycemic conditions, suggesting Robo4 might play different roles in various stages of diabetic retinopathy
26713366 These results suggest that Slit2/Robo1 binding exerts an effect on cell migration, which is negatively regulated by Robo4, and Robo1 may function by interacting with CdGAP in HUVECs.
26459591 results indicate that AP-1 complexes regulate Robo4 gene expression in endothelial cells
26066603 Increased or decreased expression of Robo4 by stimulation or knockdown of HIF-1alpha suggesting that Robo4 is positively regulated by HIF-1alpha under normoxic and hypoxic conditions in microvascular endothelial cells in vitro.
25859844 Overexpression of Roundabout4 is associated with glioma.
25833462 Robo4 suppressed glioma-induced endothelial cell proliferation, migration and tube formation in vitro by inhibiting VEGR2-mediated activation of PI3K/AKT and FAK signaling pathways.
25794001 BM Robo4 expression can serve as a new biomarker to predict clinical outcomes in AML patients and Robo4 may serve as a potential therapeutic target in patients with higher Robo4 expression.
25470344 This study demonistrated that roundabout 4 regulates blood-tumor barrier permeability through the modulation of ZO-1, Occludin, and Claudin-5 expression.
25360813 Plasma Robo4 levels are increased, transiently, following cardiac surgery requiring CPB
24855053 Endothelial cell-specific DNA methylation pattern of the Robo4 proximal promoter is determined during cell differentiation and contributes to regulation of EC-specific Robo4 gene expression.
More...

AA Sequence

MGSGGDSLLGGRGSLPLLLLLIMGGMAQDSPPQILVHPQDQLFQGPGPARMSCQASGQPPPTIRWLLNGQ      1 - 70
PLSMVPPDPHHLLPDGTLLLLQPPARGHAHDGQALSTDLGVYTCEASNRLGTAVSRGARLSVAVLREDFQ     71 - 140
IQPRDMVAVVGEQFTLECGPPWGHPEPTVSWWKDGKPLALQPGRHTVSGGSLLMARAEKSDEGTYMCVAT    141 - 210
NSAGHRESRAARVSIQEPQDYTEPVELLAVRIQLENVTLLNPDPAEGPKPRPAVWLSWKVSGPAAPAQSY    211 - 280
TALFRTQTAPGGQGAPWAEELLAGWQSAELGGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEKVPSAP    281 - 350
PQEVTLKPGNGTVFVSWVPPPAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQV    351 - 420
AAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPWTLEQLRATLKRPEVIATCGVALWLLLLGTAVCIH    421 - 490
RRRRARVHLGPGLYRYTSEDAILKHRMDHSDSQWLADTWRSTSGSRDLSSSSSLSSRLGADARDPLDCRR    491 - 560
SLLSWDSRSPGVPLLPDTSTFYGSLIAELPSSTPARPSPQVPAVRRLPPQLAQLSSPCSSSDSLCSRRGL    561 - 630
SSPRLSLAPAEAWKAKKKQELQHANSSPLLRGSHSLELRACELGNRGSKNLSQSPGAVPQALVAWRALGP    631 - 700
KLLSSSNELVTRHLPPAPLFPHETPPTQSQQTQPPVAPQAPSSILLPAAPIPILSPCSPPSPQASSLSGP    701 - 770
SPASSRLSSSSLSSLGEDQDSVLTPEEVALCLELSEGEETPRNSVSPMPRAPSPPTTYGYISVPTASEFT    771 - 840
DMGRTGGGVGPKGGVLLCPPRPCLTPTPSEGSLANGWGSASEDNAASARASLVSSSDGSFLADAHFARAL    841 - 910
AVAVDSFGFGLEPREADCVFIDASSPPSPRDEIFLTPNLSLPLWEWRPDWLEDMEVSHTQRLGRGMPPWP    911 - 980
PDSQISSQRSQLHCRMPKAGASPVDYS                                               981 - 1007
//

Text Mined References (43)

PMID Year Title
27041242 2016 Validation of RT-qPCR reference genes and determination of Robo4 expression levels in human retinal endothelial cells under hypoxia and/or hyperglycemia.
26713366 2016 Suppression of Slit2/Robo1 mediated HUVEC migration by Robo4.
26459591 2015 Expression of the Robo4 receptor in endothelial cells is regulated by two AP-1 protein complexes.
26066603 2015 Investigation of the Regulation of Roundabout4 by Hypoxia-Inducible Factor-1? in Microvascular Endothelial Cells.
25859844 2015 Overexpression of Roundabout4 predicts poor prognosis of primary glioma patients via correlating with microvessel density.
25833462 2015 Roundabout4 suppresses glioma-induced endothelial cell proliferation, migration and tube formation in vitro by inhibiting VEGR2-mediated PI3K/AKT and FAK signaling pathways.
25794001 2015 Clinical and prognostic implications of Roundabout 4 (robo4) in adult patients with acute myeloid leukemia.
25470344 2015 Roundabout 4 regulates blood-tumor barrier permeability through the modulation of ZO-1, Occludin, and Claudin-5 expression.
25360813 2014 Raised plasma Robo4 and cardiac surgery-associated acute kidney injury.
24855053 2014 Endothelial cell-specific expression of roundabout 4 is regulated by differential DNA methylation of the proximal promoter.
More...