Property Summary

NCBI Gene PubMed Count 44
PubMed Score 103.92
PubTator Score 46.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
breast carcinoma -1.200 3.6e-04
ductal carcinoma in situ -1.700 3.2e-04
group 3 medulloblastoma 1.300 4.3e-03
interstitial cystitis 1.300 6.2e-05
intraductal papillary-mucinous adenoma (... -1.400 5.3e-05
intraductal papillary-mucinous carcinoma... -1.800 1.0e-04
intraductal papillary-mucinous neoplasm ... -2.000 4.3e-04
invasive ductal carcinoma -2.300 3.1e-04
lung adenocarcinoma -1.200 1.8e-18
lung carcinoma -1.200 6.2e-09
non-small cell lung cancer -2.798 2.4e-27
osteosarcoma -2.288 2.0e-03
ovarian cancer -1.400 7.5e-06

Gene RIF (36)

AA Sequence

MGSGGDSLLGGRGSLPLLLLLIMGGMAQDSPPQILVHPQDQLFQGPGPARMSCQASGQPPPTIRWLLNGQ      1 - 70
PLSMVPPDPHHLLPDGTLLLLQPPARGHAHDGQALSTDLGVYTCEASNRLGTAVSRGARLSVAVLREDFQ     71 - 140
IQPRDMVAVVGEQFTLECGPPWGHPEPTVSWWKDGKPLALQPGRHTVSGGSLLMARAEKSDEGTYMCVAT    141 - 210
NSAGHRESRAARVSIQEPQDYTEPVELLAVRIQLENVTLLNPDPAEGPKPRPAVWLSWKVSGPAAPAQSY    211 - 280
TALFRTQTAPGGQGAPWAEELLAGWQSAELGGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEKVPSAP    281 - 350
PQEVTLKPGNGTVFVSWVPPPAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQV    351 - 420
AAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPWTLEQLRATLKRPEVIATCGVALWLLLLGTAVCIH    421 - 490
RRRRARVHLGPGLYRYTSEDAILKHRMDHSDSQWLADTWRSTSGSRDLSSSSSLSSRLGADARDPLDCRR    491 - 560
SLLSWDSRSPGVPLLPDTSTFYGSLIAELPSSTPARPSPQVPAVRRLPPQLAQLSSPCSSSDSLCSRRGL    561 - 630
SSPRLSLAPAEAWKAKKKQELQHANSSPLLRGSHSLELRACELGNRGSKNLSQSPGAVPQALVAWRALGP    631 - 700
KLLSSSNELVTRHLPPAPLFPHETPPTQSQQTQPPVAPQAPSSILLPAAPIPILSPCSPPSPQASSLSGP    701 - 770
SPASSRLSSSSLSSLGEDQDSVLTPEEVALCLELSEGEETPRNSVSPMPRAPSPPTTYGYISVPTASEFT    771 - 840
DMGRTGGGVGPKGGVLLCPPRPCLTPTPSEGSLANGWGSASEDNAASARASLVSSSDGSFLADAHFARAL    841 - 910
AVAVDSFGFGLEPREADCVFIDASSPPSPRDEIFLTPNLSLPLWEWRPDWLEDMEVSHTQRLGRGMPPWP    911 - 980
PDSQISSQRSQLHCRMPKAGASPVDYS                                               981 - 1007
//

Text Mined References (46)

PMID Year Title