Property Summary

NCBI Gene PubMed Count 41
PubMed Score 93.81
PubTator Score 46.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Autistic Disorder 320
Disease Target Count P-value
non-small cell lung cancer 2798 2.39602941449641E-27
lung adenocarcinoma 2714 2.56834342651083E-17
lung carcinoma 2844 6.18861390719296E-9
ovarian cancer 8492 7.4618207177881E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 5.25229895206381E-5
interstitial cystitis 2299 6.22266390119473E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.96156519431373E-5
invasive ductal carcinoma 2950 3.12317779452517E-4
ductal carcinoma in situ 1745 3.1678477985907E-4
breast carcinoma 1614 3.59966211028093E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 4.25660150066673E-4
osteosarcoma 7933 0.00202116059815248
group 3 medulloblastoma 2254 0.0042719919800888

Expression

Synonym

Accession Q8WZ75 A8K154 Q14DU7 Q8TEG1 Q96JV6 Q9H718 Q9NWJ8
Symbols MRB
ECSM4

Gene

  Ortholog (10)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (33)

PMID Text
27041242 there was a increase in Robo4 expression under hyperglycemic conditions, while there was a decrease under hypoxic and combined hypoxic and hyperglycemic conditions, suggesting Robo4 might play different roles in various stages of diabetic retinopathy
26713366 These results suggest that Slit2/Robo1 binding exerts an effect on cell migration, which is negatively regulated by Robo4, and Robo1 may function by interacting with CdGAP in HUVECs.
26459591 results indicate that AP-1 complexes regulate Robo4 gene expression in endothelial cells
26066603 Increased or decreased expression of Robo4 by stimulation or knockdown of HIF-1alpha suggesting that Robo4 is positively regulated by HIF-1alpha under normoxic and hypoxic conditions in microvascular endothelial cells in vitro.
25859844 Overexpression of Roundabout4 is associated with glioma.
25833462 Robo4 suppressed glioma-induced endothelial cell proliferation, migration and tube formation in vitro by inhibiting VEGR2-mediated activation of PI3K/AKT and FAK signaling pathways.
25794001 BM Robo4 expression can serve as a new biomarker to predict clinical outcomes in AML patients and Robo4 may serve as a potential therapeutic target in patients with higher Robo4 expression.
25470344 This study demonistrated that roundabout 4 regulates blood-tumor barrier permeability through the modulation of ZO-1, Occludin, and Claudin-5 expression.
25360813 Plasma Robo4 levels are increased, transiently, following cardiac surgery requiring CPB
24855053 Endothelial cell-specific DNA methylation pattern of the Robo4 proximal promoter is determined during cell differentiation and contributes to regulation of EC-specific Robo4 gene expression.
More...

AA Sequence

MGSGGDSLLGGRGSLPLLLLLIMGGMAQDSPPQILVHPQDQLFQGPGPARMSCQASGQPPPTIRWLLNGQ      1 - 70
PLSMVPPDPHHLLPDGTLLLLQPPARGHAHDGQALSTDLGVYTCEASNRLGTAVSRGARLSVAVLREDFQ     71 - 140
IQPRDMVAVVGEQFTLECGPPWGHPEPTVSWWKDGKPLALQPGRHTVSGGSLLMARAEKSDEGTYMCVAT    141 - 210
NSAGHRESRAARVSIQEPQDYTEPVELLAVRIQLENVTLLNPDPAEGPKPRPAVWLSWKVSGPAAPAQSY    211 - 280
TALFRTQTAPGGQGAPWAEELLAGWQSAELGGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEKVPSAP    281 - 350
PQEVTLKPGNGTVFVSWVPPPAENHNGIIRGYQVWSLGNTSLPPANWTVVGEQTQLEIATHMPGSYCVQV    351 - 420
AAVTGAGAGEPSRPVCLLLEQAMERATQEPSEHGPWTLEQLRATLKRPEVIATCGVALWLLLLGTAVCIH    421 - 490
RRRRARVHLGPGLYRYTSEDAILKHRMDHSDSQWLADTWRSTSGSRDLSSSSSLSSRLGADARDPLDCRR    491 - 560
SLLSWDSRSPGVPLLPDTSTFYGSLIAELPSSTPARPSPQVPAVRRLPPQLAQLSSPCSSSDSLCSRRGL    561 - 630
SSPRLSLAPAEAWKAKKKQELQHANSSPLLRGSHSLELRACELGNRGSKNLSQSPGAVPQALVAWRALGP    631 - 700
KLLSSSNELVTRHLPPAPLFPHETPPTQSQQTQPPVAPQAPSSILLPAAPIPILSPCSPPSPQASSLSGP    701 - 770
SPASSRLSSSSLSSLGEDQDSVLTPEEVALCLELSEGEETPRNSVSPMPRAPSPPTTYGYISVPTASEFT    771 - 840
DMGRTGGGVGPKGGVLLCPPRPCLTPTPSEGSLANGWGSASEDNAASARASLVSSSDGSFLADAHFARAL    841 - 910
AVAVDSFGFGLEPREADCVFIDASSPPSPRDEIFLTPNLSLPLWEWRPDWLEDMEVSHTQRLGRGMPPWP    911 - 980
PDSQISSQRSQLHCRMPKAGASPVDYS                                               981 - 1007
//

Text Mined References (43)

PMID Year Title
27041242 2016 Validation of RT-qPCR reference genes and determination of Robo4 expression levels in human retinal endothelial cells under hypoxia and/or hyperglycemia.
26713366 2016 Suppression of Slit2/Robo1 mediated HUVEC migration by Robo4.
26459591 2015 Expression of the Robo4 receptor in endothelial cells is regulated by two AP-1 protein complexes.
26066603 2015 Investigation of the Regulation of Roundabout4 by Hypoxia-Inducible Factor-1? in Microvascular Endothelial Cells.
25859844 2015 Overexpression of Roundabout4 predicts poor prognosis of primary glioma patients via correlating with microvessel density.
25833462 2015 Roundabout4 suppresses glioma-induced endothelial cell proliferation, migration and tube formation in vitro by inhibiting VEGR2-mediated PI3K/AKT and FAK signaling pathways.
25794001 2015 Clinical and prognostic implications of Roundabout 4 (robo4) in adult patients with acute myeloid leukemia.
25470344 2015 Roundabout 4 regulates blood-tumor barrier permeability through the modulation of ZO-1, Occludin, and Claudin-5 expression.
25360813 2014 Raised plasma Robo4 and cardiac surgery-associated acute kidney injury.
24855053 2014 Endothelial cell-specific expression of roundabout 4 is regulated by differential DNA methylation of the proximal promoter.
More...