Property Summary

NCBI Gene PubMed Count 12
PubMed Score 262.78
PubTator Score 114.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Myocardial Ischemia 169
Disease Target Count P-value
posterior fossa group A ependymoma 1511 7.49167691232207E-8
atypical teratoid / rhabdoid tumor 4369 1.56774124549141E-6
medulloblastoma, large-cell 6234 1.62510007991421E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 2.18914047989664E-4
group 4 medulloblastoma 1875 2.58555255142732E-4
head and neck cancer 270 3.28531324798536E-4
osteosarcoma 7933 4.57857980837834E-4
ovarian cancer 8492 0.00200394997444874
pilocytic astrocytoma 3086 0.0056821443362694
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00830175391787533
oligodendroglioma 2849 0.0302399768094605
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Weaver syndrome 6 3.814 1.9
Actinomycosis 5 3.097 1.5

Expression

Synonym

Accession Q8WZ74 O43389 Q7LG11 Q9C0A5 CortBP2
Symbols Orf4
C7orf8
CORTBP2

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (3)

PMID Text
24928895 Cttnbp2 increases microtubule stability and regulates dendritic arborization.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15364959 CORTBP2 (CTTNBP2) has a transcription-dependent spatial arrangement.

AA Sequence

MATDGASCEPDLSRAPEDAAGAAAEAAKKEFDVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVF      1 - 70
IQERYGRFNLNDPFLALQRDYEAGAGDKEKKPVCTNPLSILEAVMAHCKKMQERMSAQLAAAESRQKKLE     71 - 140
MEKLQLQALEQEHKKLAARLEEERGKNKQVVLMLVKECKQLSGKVIEEAQKLEDVMAKLEEEKKKTNELE    141 - 210
EELSAEKRRSTEMEAQMEKQLSEFDTEREQLRAKLNREEAHTTDLKEEIDKMRKMIEQLKRGSDSKPSLS    211 - 280
LPRKTKDRRLVSISVGTEGTVTRSVACQTDLVTENADHMKKLPLTMPVKPSTGSPLVSANAKGSVCTSAT    281 - 350
MARPGIDRQASYGDLIGASVPAFPPPSANKIEENGPSTGSTPDPTSSTPPLPSNAAPPTAQTPGIAPQNS    351 - 420
QAPPMHSLHSPCANTSLHPGLNPRIQAARFRFQGNANDPDQNGNTTQSPPSRDVSPTSRDNLVAKQLARN    421 - 490
TVTQALSRFTSPQAGAPSRPGVPPTGDVGTHPPVGRTSLKTHGVARVDRGNPPPIPPKKPGLSQTPSPPH    491 - 560
PQLKVIIDSSRASNTGAKVDNKTVASTPSSLPQGNRVINEENLPKSSSPQLPPKPSIDLTVAPAGCAVSA    561 - 630
LATSQVGAWPAATPGLNQPACSDSSLVIPTTIAFCSSINPVSASSCRPGASDSLLVTASGWSPSLTPLLM    631 - 700
SGGPAPLAGRPTLLQQAAAQGNVTLLSMLLNEEGLDINYSCEDGHSALYSAAKNGHTDCVRLLLSAEAQV    701 - 770
NAADKNGFTPLCAAAAQGHFECVELLISYDANINHAADGGQTPLYLACKNGNKECIKLLLEAGTNRSVKT    771 - 840
TDGWTPVHAAVDTGNVDSLKLLMYHRIPAHGNSFNEEESESSVFDLDGGEESPEGISKPVVPADLINHAN    841 - 910
REGWTAAHIAASKGFKNCLEILCRHGGLEPERRDKCNRTVHDVATDDCKHLLENLNALKIPLRISVGEIE    911 - 980
PSNYGSDDLECENTICALNIRKQTSWDDFSKAVSQALTNHFQAISSDGWWSLEDVTCNNTTDSNIGLSAR    981 - 1050
SIRSITLGNVPWSVGQSFAQSPWDFMRKNKAEHITVLLSGPQEGCLSSVTYASMIPLQMMQNYLRLVEQY   1051 - 1120
HNVIFHGPEGSLQDYIVHQLALCLKHRQMAAGFSCEIVRAEVDAGFSKEQLLDLFISSACLIPVKQSPSK   1121 - 1190
KKIIIILENLEKSSLSELLRDFLAPLENRSTESPCTFQKGNGLSECYYFHENCFLMGTIAKACLQGSDLL   1191 - 1260
VQQHFRWVQLRWDGEPMQGLLQRFLRRKVVNKFKGQAPSPCDPVCKIVDWALSVWRQLNSCLARLGTPEA   1261 - 1330
LLGPKYFLSCPVVPGHAQVTVKWMSKLWNGVIAPRVQEAILSRASVKRQPGFGQTTAKRHPSQGQQAVVK   1331 - 1400
AALSILLNKAVLHGCPLPRAELDQHTADFKGGSFPLSIVSSYNTCNKKKGESGAWRKVNTSPRRKSGRFS   1401 - 1470
LPTWNKPDLSTEGMKNKTISQLNCNRNASLSKQKSLENDLSLTLNLDQRLSLGSDDEADLVKELQSMCSS   1471 - 1540
KSESDISKIADSRDDLRMFDSSGNNPVLSATINNLRMPVSQKEVSPLSSHQTTECSNSKSKTELGVSRVK   1541 - 1610
SFLPVPRSKVTQCSQNTKRSSSSSNTRQIEINNNSKEVNWNLHKNEHLEKPNK                    1611 - 1663
//

Text Mined References (15)

PMID Year Title
24928895 2014 Cortactin-binding protein 2 increases microtubule stability and regulates dendritic arborization.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364959 2004 Transcription-dependent spatial arrangements of CFTR and adjacent genes in human cell nuclei.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
More...