Property Summary

NCBI Gene PubMed Count 19
Grant Count 28
R01 Count 20
Funding $3,533,170.27
PubMed Score 103.83
PubTator Score 6.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.165 0.000
juvenile dermatomyositis 1.256 0.000
acute quadriplegic myopathy 1.696 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.004
spina bifida -1.227 0.036
gastric carcinoma 1.100 0.030
ovarian cancer 2.100 0.000

Gene RIF (7)

PMID Text
24114843 EGF, which signals through CRAF, and an activated BRAF mutant also activate PKC and stimulate cell migration through up-regulating RFFL expression.
21308745 data indicate AE induces caspase-8-mediated activation of mitochondrial death pathways by decreasing the stability of CARP mRNAs in a p53-independent manner.
20677014 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19305408 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
18450452 acts at the level of endocytic vesicles to limit the intensity of TNF-induced NF-kappaB activation by the regulated elimination of a necessary signaling component within the receptor complex
18382127 CARPs together with MDM2 enhance p53 degradation, thereby inhibiting p53-mediated cell death.

AA Sequence

MWATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNF      1 - 70
CMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVI     71 - 140
SQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSSAQATSVPPAQVQENQQANGHVSQDQEEPV    141 - 210
YLESVARVPAEDETQSIDSEDSFVPGRRASLSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELME    211 - 280
RVTRLYKDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPIC    281 - 350
RQYVIRAVHVFRS                                                             351 - 363
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24114843 2013 Different Raf protein kinases mediate different signaling pathways to stimulate E3 ligase RFFL gene expression in cell migration regulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22609986 2012 PRR5L degradation promotes mTORC2-mediated PKC-? phosphorylation and cell migration downstream of G?12.
21308745 2011 Destabilization of CARP mRNAs by aloe-emodin contributes to caspase-8-mediated p53-independent apoptosis of human carcinoma cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19946888 2010 Defining the membrane proteome of NK cells.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
More...