Property Summary

NCBI Gene PubMed Count 20
PubMed Score 111.30
PubTator Score 6.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.696 1.7e-07
gastric carcinoma 1.100 3.0e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.9e-03
juvenile dermatomyositis 1.256 5.5e-11
osteosarcoma -2.165 3.6e-06
ovarian cancer -1.700 1.6e-05
spina bifida -1.227 3.6e-02

 MGI Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (8)

AA Sequence

MWATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNF      1 - 70
CMTCSSQVGNGPRLCLLCQRFRATAFQREELMKMKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVI     71 - 140
SQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSSAQATSVPPAQVQENQQANGHVSQDQEEPV    141 - 210
YLESVARVPAEDETQSIDSEDSFVPGRRASLSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELME    211 - 280
RVTRLYKDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPIC    281 - 350
RQYVIRAVHVFRS                                                             351 - 363
//

Text Mined References (24)

PMID Year Title