Property Summary

NCBI Gene PubMed Count 10
Grant Count 32
R01 Count 24
Funding $3,785,960.93
PubMed Score 19.37
PubTator Score 95.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
pancreatic cancer 2.000 0.000
malignant mesothelioma -5.000 0.000
astrocytic glioma -1.700 0.009
psoriasis 1.800 0.001
osteosarcoma 2.344 0.001
cystic fibrosis 4.539 0.000
glioblastoma 2.000 0.039
juvenile dermatomyositis 1.388 0.000
primary pancreatic ductal adenocarcinoma 1.934 0.001
non-small cell lung cancer 2.505 0.000
intraductal papillary-mucinous adenoma (... -1.100 0.000
X-linked cerebral adrenoleukodystrophy -1.700 0.027
lung cancer 3.900 0.000
active Crohn's disease 2.164 0.001
interstitial cystitis 2.600 0.000
pancreatic carcinoma 2.000 0.000
lung adenocarcinoma 1.300 0.000
gastric carcinoma 2.600 0.012
ulcerative colitis 3.000 0.000
ovarian cancer 3.500 0.001
pituitary cancer -4.200 0.000

Gene RIF (2)

PMID Text
16737913 RIS1 exhibits frameshift mutations in high-frequency microsatellite instability tumors, and its alteration is correlated with mutations in two target genes BAX and TGFBR2, linking it to the mutator pathway in colorectal carcinogenesis.
16280139 Suggested role of Ris-1 as tumor suppressor gene is not evident, at least in breast cancer.

AA Sequence

MLPLLAALLAAACPLPPVRGGAADAPGLLGVPSNASVNASSADEPIAPRLLASAAPGPPERPGPEEAAAA      1 - 70
AAPCNISVQRQMLSSLLVRWGRPRGFQCDLLLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDL     71 - 140
RLCVGCGWVRGRRTGRLRPAAAPSAAAATAGAPTALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGE    141 - 210
PGWRLNRKPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTASTTAATPAAVPAGTTAA    211 - 280
AAAAAAAAAAAAVTSGVATK                                                      281 - 300
//

Text Mined References (13)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
20210993 2010 Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16737913 2006 RIS1, a gene with trinucleotide repeats, is a target in the mutator pathway of colorectal carcinogenesis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16575872 2006 Target genes of the WNT/beta-catenin pathway in Wilms tumors.
16280139 2006 Analysis of the candidate tumor suppressor Ris-1 in primary human breast carcinomas.
16083501 2005 Tumor suppressor in lung cancer 1 (TSLC1) alters tumorigenic growth properties and gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15486950 2004 Microdissection and SAGE as a combined tool to reveal gene expression in ductal carcinoma in situ of the breast.
More...