Property Summary

NCBI Gene PubMed Count 10
PubMed Score 19.51
PubTator Score 95.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 2.164 1.2e-03
astrocytic glioma -1.700 8.9e-03
cystic fibrosis 4.539 9.3e-08
gastric carcinoma 2.600 1.2e-02
glioblastoma 2.000 3.9e-02
interstitial cystitis 2.600 2.2e-06
intraductal papillary-mucinous adenoma (... -1.100 8.7e-05
juvenile dermatomyositis 1.388 5.3e-09
lung adenocarcinoma 1.300 2.4e-04
lung cancer 2.200 2.5e-05
malignant mesothelioma -5.000 9.3e-09
non-small cell lung cancer 2.505 8.1e-13
osteosarcoma 2.344 1.3e-03
ovarian cancer 3.500 9.1e-04
pancreatic cancer 2.000 1.8e-04
pancreatic carcinoma 2.000 1.8e-04
pituitary cancer -4.200 9.3e-12
primary pancreatic ductal adenocarcinoma 1.934 1.4e-03
psoriasis 1.800 1.4e-03
ulcerative colitis 3.000 2.0e-08
X-linked cerebral adrenoleukodystrophy -1.700 2.7e-02

Gene RIF (2)

AA Sequence

MLPLLAALLAAACPLPPVRGGAADAPGLLGVPSNASVNASSADEPIAPRLLASAAPGPPERPGPEEAAAA      1 - 70
AAPCNISVQRQMLSSLLVRWGRPRGFQCDLLLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDL     71 - 140
RLCVGCGWVRGRRTGRLRPAAAPSAAAATAGAPTALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGE    141 - 210
PGWRLNRKPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTASTTAATPAAVPAGTTAA    211 - 280
AAAAAAAAAAAAVTSGVATK                                                      281 - 300
//

Text Mined References (13)

PMID Year Title