Property Summary

NCBI Gene PubMed Count 1
PubMed Score 50.25
PubTator Score 74.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1663 1.1e-03
Disease Target Count Z-score Confidence
alcohol-related birth defect 3 4.437 2.2
Delusional disorder 10 3.459 1.7

Synonym

Accession Q8WZ69
Symbols NOV1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALVQALVPREREPKLSILQMDRGDPQHSSHWCPEREKVKLLTLKPRETSKNILINFYRAFNLDKDVFIH      1 - 70
QANHPLTVPSSVVMGDNGHTLAEDDKRPCFRVLPCYLERVSSGISISWISAPLPVGAMKHQLLCDLMDLI     71 - 140
TLSFWLAGQCMSLKATNMQHCKCSIATSDWAIELDRTDYKTLPSEYSILALLQVFAGKNCMDRVLLHVDV    141 - 210
NYLKSLP                                                                   211 - 217
//

Text Mined References (1)

PMID Year Title
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.