Property Summary

NCBI Gene PubMed Count 16
PubMed Score 40.99
PubTator Score 6.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -3.200 4.2e-05
cystic fibrosis 1.522 1.1e-05
facioscapulohumeral dystrophy 2.100 2.5e-02
glioblastoma -1.700 4.8e-03
group 3 medulloblastoma -3.800 2.1e-07
interstitial lung disease -1.200 4.6e-02
intraductal papillary-mucinous adenoma (... 1.500 1.5e-02
lung adenocarcinoma -1.500 1.0e-12
lung cancer -1.400 3.3e-03
lung carcinoma -3.800 2.0e-45
malignant mesothelioma -1.900 1.2e-07
medulloblastoma, large-cell -4.500 5.8e-08
non primary Sjogren syndrome sicca 1.100 1.4e-02
non-small cell lung cancer -1.537 1.7e-15
osteosarcoma -3.216 2.5e-04
ovarian cancer -2.300 6.1e-07
pediatric high grade glioma -1.300 3.6e-03
pituitary cancer -1.200 3.9e-03
primitive neuroectodermal tumor -2.500 8.4e-03
progressive supranuclear palsy -1.200 1.4e-02
spina bifida -1.545 4.2e-02

Gene RIF (4)

AA Sequence

MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRILKQLQIILSK      1 - 70
MQDIPIYANVHKTKKNDDPSKDYHVPSSDQNICIELSNSGSVQTSSPPQLETVRKNLEDSDASVERSQYP     71 - 140
QSDDKLSPPKRDFPTAEEPHLNLGSLNDSLFGSDNIKIESLITKKTVDHTVEEQQTEKVKLITENLSKLP    141 - 210
NADSECLSFVGCSTSGTNSGNGTNGLLEGSPPSPFFKFQGEMIVNDLYVPSSPILAPVRSRSKLVSRPSR    211 - 280
SFLLRHRPVPEIPGSTKGVSGSYFRERRNVATSTEKSVAWQNSNEENSSSIFPYGETFLFQRLENSKKRS    281 - 350
IKNEFLTQGEALKGEAATATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEE    351 - 420
CFQSLRRKNSKASKSRTQKALILDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGASAKKVKSGWLD    421 - 490
KLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGDNKFEVVTTQRTFVFRVEKEE    491 - 560
ERNDWISILLNALKSQSLTSQSQAVVTPEKCGYLELRGYKAKIFTVLSGNSVWLCKNEQDFKSGLGITII    561 - 630
PMNVANVKQVDRTVKQSFEIITPYRSFSFTAETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSC    631 - 700
ADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGN    701 - 770
LQKDEELHMDSPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMC    771 - 840
ATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLYQAPSAASKLS    841 - 910
SEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAIHKEDFYLNTGPIFIFEIYLPSERV    911 - 980
FLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQLFYKDCHALDQWRKGWFAMDKSSLHFCLQM    981 - 1050
QEVQGDRMHLRRLQELTISTMVQNGEKLDVLLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQD   1051 - 1120
QQLSKNDVPIIVNSCIAFVTQYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLK   1121 - 1190
SFLSDIDDALLTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMN   1191 - 1260
AHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLI   1261 - 1330
EVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVIENEELERPLHYKENVLEQVL   1331 - 1400
RWSSLAEPGSAYLVVKRFLTADTIKHCSDRSTLGSIKEGILKIKEEPSKILSGNKFQDRYFVLRDGFLFL   1401 - 1470
YKDVKSSKHDKMFSLSSMKFYRGVKKKMKPPTSWGLTAYSEKHHWHLCCDSSRTQTEWMTSIFIAQHEYD   1471 - 1540
IWPPAGKERKRSITKNPKIGGLPLIPIQHEGNATLARKNIESARAELERLRLSEKCDKESVDSSLKERAS   1541 - 1610
MVAHCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVI   1611 - 1680
EELNVVLQRSRTLPKELQDEQILK                                                 1681 - 1704
//

Text Mined References (16)

PMID Year Title