Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.91
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 4.9e-08
pituitary cancer 1972 2.5e-02

Expression

  Differential Expression (2)

Disease log2 FC p
nasopharyngeal carcinoma -2.400 4.9e-08
pituitary cancer 1.300 2.5e-02

Synonym

Accession Q8WZ59 A6NJL5
Symbols MDAC1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MLGCGIPALGLLLLLQGSADGNGIQGFFYPWSCEGDIWDRESCGGQAAIDSPNLCLRLRCCYRNGVCYHQ      1 - 70
RPDENVRRKHMWALVWTCSGLLLLSCSICLFWWAKRRDVLHMPGFLAGPCDMSKSVSLLSKHRGTKKTPS     71 - 140
TGSVPVALSKESRDVEGGTEGEGTEEGEETEGEEEED                                     141 - 177
//

Text Mined References (6)

PMID Year Title