Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MLCPRAAFLVGSFHGVFPGPPASSHWEFWVPSTPVGAYFCPPQPQLTPPNTPKLVSEVEELYKSITALRE      1 - 70
KLLQAEQSLRNLKDIHMSLEKDVTAMTNSVFIDRQKCMAHRTCYPTILQLAGYQ                     71 - 124
//

Text Mined References (9)

PMID Year Title