Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 3.50

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
21834855 MAFIP overexpression inhibited activation of the NF-kappaB pathway by preventing the phosphorylation of IKK & IkappaBalpha, degradation of IkappaBalpha & p65 nuclear localization. Knockdown of MAFIP activated the NF-kappaB pathway & promoted cell proliferation.
21109981 results indicated that MIP interacted with NEMO and suggested that MIP could be involved in NF-kappaB signaling pathway

AA Sequence

MLCPRAAFLVGSFHGVFPGPPASSHWEFWVPSTPVGAYFCPPQPQLTPPNTPKLVSEVEELYKSITALRE      1 - 70
KLLQAEQSLRNLKDIHMSLEKDVTAMTNSVFIDRQKCMAHRTCYPTILQLAGYQ                     71 - 124
//

Text Mined References (9)

PMID Year Title
21834855 2011 MAFIP is a tumor suppressor in cervical cancer that inhibits activation of the nuclear factor-kappa B pathway.
21109981 2011 Finding a novel interacting protein of the hepatic carcinoma related gene MIP: NF-?B essential modulator (NEMO).
19723544 2009 Establish a recombinant yeast detection system to study the effect of MIP on transactivation function of hMafF in US2-driven gene transcription.
16549056 2006 The novel human gene MIP functions as a co-activator of hMafF.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15881666 2005 P5644 interacts with phosphatidylinositol-4-phosphate adaptor protein-1 associated protein-1.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.