Knowledge Summary

Patent

No data available

Synonym

Accession Q8WZ26
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MCEQLVCIFTYAYLKINLTKALGHHNPSYPVARAQPQTMFPSASECNAFPRVSKVPNRSGAAETALLVRV      1 - 70
LPKPLKSQASLLSLPFIHITEQLSTHICVVLFKLFHVCLFTINNMNDCSMDAAERNAEGGLQLE           71 - 134
//

Text Mined References (3)

PMID Year Title