Knowledge Summary

Patent

No data available

Synonym

Accession Q8WZ26
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MCEQLVCIFTYAYLKINLTKALGHHNPSYPVARAQPQTMFPSASECNAFPRVSKVPNRSGAAETALLVRV      1 - 70
LPKPLKSQASLLSLPFIHITEQLSTHICVVLFKLFHVCLFTINNMNDCSMDAAERNAEGGLQLE           71 - 134
//

Text Mined References (3)

PMID Year Title
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.