Property Summary

NCBI Gene PubMed Count 14
PubMed Score 19.08
PubTator Score 13.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.300 2.7e-02
Astrocytoma, Pilocytic -2.100 8.6e-07
Breast cancer -1.400 1.5e-03
breast carcinoma 1.600 1.6e-04
chronic rhinosinusitis -2.037 3.2e-02
ductal carcinoma in situ 1.100 1.2e-03
ependymoma 2.400 8.1e-07
fibroadenoma 1.700 8.3e-03
glioblastoma -1.500 3.6e-03
group 3 medulloblastoma -2.800 1.3e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.8e-02
lung adenocarcinoma -1.100 4.6e-03
medulloblastoma, large-cell -3.400 3.3e-05
nasopharyngeal carcinoma -3.600 2.6e-06
non-small cell lung cancer -1.075 2.9e-03
psoriasis -1.100 6.9e-38

Gene RIF (4)

AA Sequence

MSDLGSEELEEEGENDIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGE      1 - 70
YVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGT     71 - 140
WVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWK    141 - 210
ATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESRE    211 - 280
YDQEEFRYDMDEGNINSEEEETRQSDLQD                                             281 - 309
//

Text Mined References (15)

PMID Year Title