Property Summary

NCBI Gene PubMed Count 18
Grant Count 7
R01 Count 4
Funding $445,195.49
PubMed Score 26.83
PubTator Score 29.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (10)

PMID Text
26173259 data argue for differential regulatory functions of the non-catalytic subunits and a specific Gbetagamma-dependent regulation of p101 in PI3Kgamma activation.
25374236 PIK3R5 promoter hypermethylation is associated with oral squamous cell carcinoma.
24014027 expression and activities of PI3Kgamma are modified differently by p87 and p101 in vitro and in living cells, arguing for specific regulatory roles of the non-catalytic subunits in the differentiation of PI3Kgamma signaling pathways.
22065524 Our characterization of the PIK3R5 protein and findings suggest that it may play a role in the development of the cerebellum and vermis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
17486067 Overexpression of p101 activates PI3Kgamma signaling and is associated with T-cell lymphomas
15611065 analysis of functional domains in the p101 regulatory subunit of phosphoinositide 3-kinase gamma
12507995 p101 has a role in membrane recruitment and activation of PI3K gamma

AA Sequence

MQPGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLEQILQKTREVQ      1 - 70
EKGTYDLLTPLALLFYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYCSICQELLTFIDAELKAPGIS     71 - 140
YQRLVRAEQGLPIRSHRSSTVTVLLLNPVEVQAEFLAVANKLSTPGHSPHSAYTTLLLHAFQATFGAHCD    141 - 210
VPGLHCRLQAKTLAELEDIFTETAEAQELASGIGDAAEARRWLRTKLQAVGEKAGFPGVLDTAKPGKLHT    211 - 280
IPIPVARCYTYSWSQDSFDILQEILLKEQELLQPGILGDDEEEEEEEEEVEEDLETDGHCAERDSLLSTS    281 - 350
SLASHDSTLSLASSQASGPALSRHLLTSFVSGLSDGMDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQK    351 - 420
FIRIYKLFKSTSQLVLRRDSRSLEGSSDTALPLRRAGSLCSPLDEPVSPPSRAQRSRSLPQPKLGTQLPS    421 - 490
WLLAPASRPQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRRLENNRPLLTRFFKLQFFYVP    491 - 560
VKRSHGTSPGACPPPRSQTPSPPTDSPRHASPGELGTTPWEESTNDISHYLGMLDPWYERNVLGLMHLPP    561 - 630
EVLCQQSLKAEAQALEGSPTQLPILADMLLYYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHS    631 - 700
AATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSM    701 - 770
EALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYK    771 - 840
PEKSDLSSPPQTPPDLPAQAAPDLCSLLCLPIMTFSGALP                                  841 - 880
//

Text Mined References (20)

PMID Year Title
26173259 2015 Different inhibition of G??-stimulated class IB phosphoinositide 3-kinase (PI3K) variants by a monoclonal antibody. Specific function of p101 as a G??-dependent regulator of PI3K? enzymatic activity.
25374236 2014 Screening of differential promoter hypermethylated genes in primary oral squamous cell carcinoma.
24014027 2013 p87 and p101 subunits are distinct regulators determining class IB phosphoinositide 3-kinase (PI3K) specificity.
22065524 2012 A missense mutation in PIK3R5 gene in a family with ataxia and oculomotor apraxia.
20582532 2010 Phosphatidylinositol 3-kinase: the oncoprotein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18794883 2008 Class I PI3K in oncogenic cellular transformation.
More...