Property Summary

NCBI Gene PubMed Count 18
PubMed Score 28.58
PubTator Score 29.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
chronic lymphosyte leukemia -1.300 6.1e-09
interstitial cystitis 1.500 1.7e-03
invasive ductal carcinoma 1.318 1.6e-03
lung carcinoma -1.300 2.0e-16
mucosa-associated lymphoid tissue lympho... 1.021 2.7e-02
non-small cell lung cancer -1.692 9.2e-20
osteosarcoma -2.601 1.6e-04
primary Sjogren syndrome 1.200 1.3e-03
spina bifida 1.228 4.3e-02
subependymal giant cell astrocytoma 1.610 2.6e-02
ulcerative colitis 1.200 5.2e-04

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MQPGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLEQILQKTREVQ      1 - 70
EKGTYDLLTPLALLFYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYCSICQELLTFIDAELKAPGIS     71 - 140
YQRLVRAEQGLPIRSHRSSTVTVLLLNPVEVQAEFLAVANKLSTPGHSPHSAYTTLLLHAFQATFGAHCD    141 - 210
VPGLHCRLQAKTLAELEDIFTETAEAQELASGIGDAAEARRWLRTKLQAVGEKAGFPGVLDTAKPGKLHT    211 - 280
IPIPVARCYTYSWSQDSFDILQEILLKEQELLQPGILGDDEEEEEEEEEVEEDLETDGHCAERDSLLSTS    281 - 350
SLASHDSTLSLASSQASGPALSRHLLTSFVSGLSDGMDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQK    351 - 420
FIRIYKLFKSTSQLVLRRDSRSLEGSSDTALPLRRAGSLCSPLDEPVSPPSRAQRSRSLPQPKLGTQLPS    421 - 490
WLLAPASRPQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRRLENNRPLLTRFFKLQFFYVP    491 - 560
VKRSHGTSPGACPPPRSQTPSPPTDSPRHASPGELGTTPWEESTNDISHYLGMLDPWYERNVLGLMHLPP    561 - 630
EVLCQQSLKAEAQALEGSPTQLPILADMLLYYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHS    631 - 700
AATRAIKASGPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSM    701 - 770
EALTLNLTEVVKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYK    771 - 840
PEKSDLSSPPQTPPDLPAQAAPDLCSLLCLPIMTFSGALP                                  841 - 880
//

Text Mined References (20)

PMID Year Title