Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.53
PubTator Score 0.54

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
ulcerative colitis 2087 8.51411046445489E-8
tuberculosis 1563 1.16155054403306E-5
psoriasis 6685 0.00106512203744967
ovarian cancer 8492 0.00115590445669133
glioblastoma 5572 0.00494296229053738
interstitial cystitis 2299 0.00535862972655891
Disease Target Count Z-score Confidence
Vesicoureteral reflux 28 3.22 1.6


  Differential Expression (6)

Disease log2 FC p
psoriasis -1.300 0.001
glioblastoma -1.100 0.005
tuberculosis -1.300 0.000
interstitial cystitis -1.200 0.005
ulcerative colitis -1.600 0.000
ovarian cancer -1.100 0.001


Accession Q8WYQ9 D3DUN1 O60324 Q3MJD8 Q9UFP0
Symbols BDG29


  Ortholog (9)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

19460752 Knockdown of zinc finger, CCHC domain containing 14 (ZCCHC14) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

CGATGHRAQDCKQPSMDFNRPGTFRLKYAPPAESLDSTD                                   911 - 949

Text Mined References (10)

PMID Year Title
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.