Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.53
PubTator Score 0.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Alcoholic Intoxication, Chronic 289
Disease Target Count P-value
ulcerative colitis 1819 8.5e-08
tuberculosis 2010 1.2e-05
psoriasis 6694 1.1e-03
ovarian cancer 8520 1.2e-03
glioblastoma 5792 4.9e-03
interstitial cystitis 2312 5.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Vesicoureteral reflux 32 3.242 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.100 4.9e-03
interstitial cystitis -1.200 5.4e-03
ovarian cancer -1.100 1.2e-03
psoriasis -1.300 1.1e-03
tuberculosis -1.300 1.2e-05
ulcerative colitis -1.600 8.5e-08

Gene RIF (2)

AA Sequence

MASNHPAFSFHQKQVLRQELTQIQSSLNGGGGHGGKGAPGPGGALPTCPACHKITPRTEAPVSSVSNSLE      1 - 70
NALHTSAHSTEESLPKRPLGKHSKVSVEKIDLKGLSHTKNDRNVECSFEVLWSDSSITSVTKSSSEVTEF     71 - 140
ISKLCQLYPEENLEKLIPCLAGPDAFYVERNHVDLDSGLRYLASLPSHVLKNDHVRRFLSTSSPPQQLQS    141 - 210
PSPGNPSLSKVGTVMGVSGRPVCGVAGIPSSQSGAQHHGQHPAGSAAPLPHCSHAGSAGSALAYRTQMDT    211 - 280
SPAILMPSSLQTPQTQEQNGILDWLRKLRLHKYYPVFKQLSMEKFLSLTEEDLNKFESLTMGAKKKLKTQ    281 - 350
LELEKEKSERRCLNPSAPPLVTSSGVARVPPTSHVGPVQSGRGSHAAELRVEVEQPHHQLPREGSSSEYS    351 - 420
SSSSSPMGVQAREESSDSAEENDRRVEIHLESSDKEKPVMLLNHFTSSSARPTAQVLPVQNEASSNPSGH    421 - 490
HPLPPQMLSAASHITPIRMLNSVHKPERGSADMKLLSSSVHSLLSLEERNKGSGPRSSMKVDKSFGSAMM    491 - 560
DVLPASAPHQPVQVLSGLSESSSMSPTVSFGPRTKVVHASTLDRVLKTAQQPALVVETSTAATGTPSTVL    561 - 630
HAARPPIKLLLSSSVPADSAISGQTSCPNNVQISVPPAIINPRTALYTANTKVAFSAMSSMPVGPLQGGF    631 - 700
CANSNTASPSSHPSTSFANMATLPSCPAPSSSPALSSVPESSFYSSSGGGGSTGNIPASNPNHHHHHHHQ    701 - 770
QPPAPPQPAPPPPGCIVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFTFPFLPFSPMCSSGYVSAQQ    771 - 840
YGGGSTFPVVHAPYSSSGTPDPVLSGQSTFAVPPMQNFMAGTAGVYQTQGLVGSSNGSSHKKSGNLSCYN    841 - 910
CGATGHRAQDCKQPSMDFNRPGTFRLKYAPPAESLDSTD                                   911 - 949
//

Text Mined References (11)

PMID Year Title